Property Summary

Ligand Count 636
NCBI Gene PubMed Count 136
PubMed Score 1164.18
PubTator Score 199.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ileal Crohn's disease 1.853 4.3e-02
intraductal papillary-mucinous neoplasm ... 1.700 1.1e-03
invasive ductal carcinoma -1.198 2.3e-02
malignant mesothelioma -2.700 1.3e-08
non-small cell lung cancer 1.463 7.7e-12
ovarian cancer 1.100 9.4e-03
psoriasis -1.400 2.9e-04
tuberculosis -1.400 5.0e-07
ulcerative colitis 1.700 3.4e-04

 GWAS Trait (1)

PDB (16)

Gene RIF (125)

AA Sequence

MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLR      1 - 70
AHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASM     71 - 140
ALQILWEAARHL                                                              141 - 152
//

Text Mined References (139)

PMID Year Title