Property Summary

NCBI Gene PubMed Count 126
PubMed Score 1099.79
PubTator Score 199.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -2.700 1.3e-08
psoriasis -1.400 2.9e-04
tuberculosis -3.400 1.6e-08
non-small cell lung cancer 1.463 7.7e-12
intraductal papillary-mucinous neoplasm ... 1.700 1.1e-03
invasive ductal carcinoma -1.198 2.3e-02
ulcerative colitis 1.700 3.4e-04
ovarian cancer 1.100 9.4e-03
ileal Crohn's disease 1.853 4.3e-02

Gene RIF (115)

PMID Text
26560040 Altered expression of EP2 in patients with aspirin-exacerbated respiratory disease contributes to deficient induction of IL-1RI, reducing the capacity of IL-1beta to increase COX-2 and mPGES-1 expression, which results in low PGE2 production
26538827 mPGES-1 is downregulated via EGR1 and has a role in caffeine inhibition on PGE2 synthesis of HBx hepatocytes
26498686 Data show that cyclooxygenase2 (COX2)overexpression induces prostaglandin E synthase (PTGES) through early growth response 1 (EGR1) in colorectal cancer cell lines.
26113609 mPGES-1 in prostate cancer controls stemness and amplifies epidermal growth factor receptor-driven oncogenicity
25988363 Data suggest that, in organization of enzymes in post-translational endoplasmic reticulum, mPGES1 is likely co-localized with COX2 (cyclooxygenase-2) within a distance of 14.4 A; mPGES-1 is localized much farther from COX1 (cyclooxygenase-1).
25817443 results demonstrate that mPGES-1 is a target gene of defective mismatch repair in human colorectal cancer, with functional consequence
25620445 we investigated the changes in promoter methylation patterns using methylation arrays and observed that the promoters of immunomodulatory factors, COX2 and PTGES, and migration-related factors, CXCR2 and CXCR4, were hypomethylated after 5-aza treatment
25139833 This study clearly demonstrated that the human COX-2 linked to mPGES-1 is a pathway that, when mediated by the prostaglandin E receptor, is linked to promoting cancer growth in a chronic inflammatory environment
25108236 mPGES-1 expression is positively correlated to hepatitis B virus X protein expression in hepatocellular carcinoma tissue.
24886859 Data indicate that inhibition of lysine-specific demethylase 1 activity prevented IL-1beta-induced histone H3 lysine 9 (H3K9) demethylation at microsomal prostaglandin E synthase 1 (mPGES-1) promoter.
24876670 the microsomal PGE2-synthase-1/PGE-receptor-4 axis is increased by smoking in human abdominal aortic aneurysms
24771596 High levels of intra tumoral mPGES-1 is associated with poor prognosis. mPGES-1 after chemotherapy is associated with improved outcomes.
24711448 Data indicate that the Tibetan prolyl hydroxylase domain protein 2 (PHD2) haplotype (D4E/C127S) strikingly diminishes the interaction of PHD2 with heat shock protein 90 co-chaperone protein p23 (prostaglandin E synthase).
24133193 potential relevance of the COX-2/mPGES-1/EP-4 axis in the AAA-associated hypervascularization
23913682 mPGES1 is a target gene of KLF5 in human breast cancer celsl
23900502 COX-2 and mPGES-1 were highly expressed in PSC-associated CCA tissues and non-neoplastic BDECs in PSC, suggesting the involvement of COX-2 and mPGES-1 in cholangiocarcinogenesis.
23791007 mPGES1 expression was associated with multiple malignant characteristics and enhanced tumorigenesis in hepatocellular carcinoma
23553915 microsomal PGES-1 (mPGES-1) is induced, and its expression is associated with beta-amyloid (Abeta) plaques in the cerebral cortex in human AD patients.
23439561 Knockdown of NF-kappaB1 p50 by p50 siRNA significantly decreased acid-induced increase in mPGES1 expression.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of prostaglandin E synthase (PTGES) in peptide-treated PBMCs
23252918 Relationship between TLR4 and mPGES-1 mRNA in endometriotic lesions indicate that innate immunity may play an important role in the pathogenesis of endometriosis.
22822059 Cyclooxygenase-2, not microsomal prostaglandin E synthase-1, is the mechanism for interleukin-1beta-induced prostaglandin E2 production and inhibition of insulin secretion in pancreatic islets
22588264 Cyclooxygenase-2/mPGES-1 are expressed in the wall of human cerebral aneurysms and more abundantly so in ruptured aneurysms than in nonruptured.
22511203 S. officinalis extracts and its ingredients carnosol and carnosic acid inhibit PGE(2) formation by selectively targeting mPGES-1.
22342541 NM 004878 NM 004878
22308510 IL-1 released by head and neck squamous cell carcinoma cells plays a key role in inducing the expression of COX-2 and mPGES-1 in fibroblasts.
22260630 identified two DNase I-hypersensitive sites within the proximal promoter near the Egr-1 element and a novel distal site near -8.6 kb
22137787 imidazoquinolines represent a novel structural class of microsomal prostaglandin E synthase-1 inhibitors
22081067 a tight cooperation between the EGF/EGFR and mPGES-1 leads to a significant tumorigenic gain in epithelial cells
21925143 Treatment of Ca9-22 cells and HOK with oxLDL induced an up-regulation of IL-8 and the PGE(2)-producing enzymes, cyclooxygenase-2 and microsomal PGE(2) synthase-1.
21907186 The present study was aimed at addressing the hypothesis that the activated state of RhoA GTPase signals can trigger mPGES-1.
21842276 In meniscal cells from osteoarthritic knees, AGEs increased the production of inflammatory mediators, including PGE(2), COX-2 and mPGES-1
21805999 Study of specific inhibitor binding sites of MPGES1 demonstrates the glutathione binding site and a hydrophobic cleft in the protein thought to accommodate the prostaglandin H2 substrate.
21743491 Data show a crosstalk between mPGES-1/PGE(2) and EGR1/beta-catenin signaling that is critical for hepatocarcinogenesis.
21645444 Over-expression of mPGES-1 was associated with tumorigenesis and progression of hepatocellular carcinoma.
21448233 Study found that gene polymorphisms in PTGES might have not only a disease-predisposing impact but also a disease-modifying effect, as two SNPs within PTGES gene were related to early disease onset.
21354147 mPGES-1 promotes experimental cholangiocarcinogenesis and tumor progression by inhibiting PTEN.
21277871 Tumor cell-induced COX-2 and mPGES-1 in human microvascular endothelial cells was strongly inhibited by the IL-1-receptor antagonist, indicating the important implication of tumor-derived IL-1 in this effect.
21277633 These results stress the essential roles of JAK1 and STAT6 in the early signaling pathway of IL-4 and IL-13 leading to suppression of COX-2 expression and repression of prostaglandin production.
21239760 Data show that the suppressive effect of valproic acid on chondrocytes is not due to reduced expression or recruitment of Egr-1 to the mPGES-1 promoter and involves upregulation of NAB1.
21052031 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20939114 Data suggest that increased mPGES-1 expression in non-cancerous liver tissues is closely associated with the early recurrence of HCC after curative resection.
20635443 The study shows that cPLA2 and mPGES-1, in addition to COX-2, are constitutively overexpressed, and that 15-PGDH might be attenuated in colorectal cancer. Furthermore, cPLA2 and 15-PGDH as well as COX-2 could have an important role in tumor progression.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20605783 Data identified key residues Thr-131, Leu-135, and Ala-138 in human MPGES1, which play a crucial role as gate keepers for the active site of MPGES1.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20369883 microscopic binding of human microsomal prostaglandin E synthase-1 (mPGES-1) trimer with substrate PGH2 and cofactor GSH
20140262 Observational study of gene-disease association. (HuGE Navigator)
20086108 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20042640 PTGES is a novel HIF-1alpha target gene. It is among the commonly upregulated genes in esophageal squamous cell carcinoma & the cells exposed to hypoxia. It is involved in prostaglandin E biosynthesis in the esophageal tumor hypoxic microenvironment.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19846775 MPGES-1 knockdown conferred decreased clonogenic capacity and slower growth of xenograft tumors (with disintegrated tissue structure) in nude mice.
19802674 IL-1beta markedly enhanced the expression of COX-2 and microsomal prostaglandin E synthase-1 (mPGES-1)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19428335 The production of PGE(2) was decreased by HO-1 induction as a result of diminished mPGES-1 protein and mRNA expression.
19412621 These results indicate that mPGES-1 and mPGES-2 may each play a role in colorectal cancer progression.
19399588 mPGES-1 may be coupled to COX-1. ABCC4 up-regulation further supports the assumption of its involvement in prostanoid transport
19347995 all three terminal prostaglandin synthases, mPGES-1, mPGES-2, and cPGES, are over-expressed in human gliomas
19343046 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19276290 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19115247 HDAC4 contributes to transcriptional induction of mPGES-1 by IL-1 through a mechanism involving up-regulation of Egr-1 transcriptional activity
19114118 Data demonstrate the coregulation of cPLA(2), COX, and mPGES-1, in PGE(2) synthesis pathway, and that these enzymes contribute to the elevation of PGE(2) level when one COX isoform is absent.
19053751 microsomal prostaglandin E2 synthase-1 and 5-lipoxygenase can be inhibited by pirinixic acid derivatives
19046748 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19035518 demonstrate a novel association between APC functional status and mPGES-1 expression in colorectal tumor cells, being most likely related to reduced mPGES-1 mRNA degradation rate in the APC wild type state
19019335 Observational study of gene-disease association. (HuGE Navigator)
19017494 Expression and purification of human mPGES-1 in E. coli and identification of inhibitory compounds.
18984580 R126A and R126Q mPGES-1 exhibit a novel, glutathione-dependent, reductase activity, which allows conversion of prostaglandin H2 into prostaglandin F2alpha.
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18631945 microsomal prostaglandin-E synthase is normally expressed constitutively in human neurons, microglia, astrocytes, and endothelial cells but is up-regulated in Alzheimer's disease
18555503 7-hydroxyandrosterone decreased mPGES-1 expression.
18479189 Results show that GPx2 by compartmentalized removal of hydroperoxides silences COX-2 activity and suppresses PGE(2)-dependent COX-2 and mPGES-1 expression.
18050215 Transcription factor HIF-1alpha is involved in the up-regulation of mPGES-1 and may therefore play an important role in the metabolism of osteoarthritic cartilage.
18038187 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17968936 microparticles up-regulate the production of PGE(2) in synovial fibroblasts by inducing COX-2 and mPGES-1 in rheumatoid arthritis
17928629 The results of this study results support a role for NFkappaB in cytokine-induced prostaglandin E synthase expression in amnion mesenchymal cells in vitro.
17708577 PAR2 stimulation up-regulated mPGES-1 as well as COX-2, but not mPGES-2 or cPGES, leading to PGE(2) formation.
17707523 mPGES-1 siRNA down-regulates mPGES-1 expression, and neither mPGES-2 nor cPGES substituted for mPGES-1 in a knockdown setting in gingival fibroblasts.
17697149 Carbonyl reductase-1 (CBR1), microsomal prostaglandin E synthase-1 and 2 (mPGES-1, mPGES-2), cytosolic prostaglandin E synthase (cPGES), aldoketoreductase (AKR1C1) and prostaglandin F synthase (AKR1C3) were all expressed in hair follicles.
17696939 Demonstrate increased microsomal prostaglandin E synthase in hepatocellular carcinoma tissues from patients with viral hepatitis.
17680542 The findings suggests that mPGES-1 might play a role in pathogenesis of atheroscleros and modulation of inflammatory process involved in plaque stability.
17505022 Regulation of the microsomal PTGES in polarized mononuclear phagocytes and its constitutive expression in neutrophils were studied.
17295901 Results suggest that expression of microsomal PGES in addition to COX-2 plays a role in increasing PGE(2) production in endometriosis.
16952028 Microsomal prostaglandin e synthase-1 overexpression is associated with human non-small-cell lung cancer
16891468 mPGES-1 plays a critical role in promoting astroglioma cell growth via PGE(2)-dependent activation of type II PKA
16598755 These findings demonstrate a coordinated induction of COX-2 and mPGES-1 by PDB/TG that proceeds through PKC/ERK and Ca2+ signaling cascades, resulting in increased PGE2 production.
16212965 Patients with carotid atherosclerosis depict an overexpression of COX-2, mPGES-1 and EPs in blood mononuclear cells and plaque of patients with carotid atherosclerosis regulated by nuclear factor-kappaB
15870920 Significantly higher expression of microsomal prostaglandin E synthase is associated with metastasis in non-small cell lung cancer
15868626 mPGES-1 expression is upregulated in osteoarthritis versus normal cartilage and proinflammatory cytokines increased mPGES-1 expression in chondrocytes
15789615 Is this okay for pge synthase 1? PGH synthase-2, CYP4F8, and PGE synthase-1 likely forms 19-hydroxy-PGE compounds in seminal vesicles and vas deferens
15379214 microsomal PGES-1 regulates PGE2 production in gingival fibroblasts stimulated by inflammatory mediators IL-1beta and TNFa
15234907 cigarette smoke induced 25-fold increase in microsomal prostaglandin E synthase, the key enzyme involved in the production of PGE2
15188353 The demonstration of mPGES-1 expression in synovial tissues from patients with rheumatoid arthritis suggests a role for mPGES-1 in the disease process.
15167446 Observational study of gene-disease association. (HuGE Navigator)
15023995 mPGES-1 and Egr-1 are novel targets of PPARgamma and inhibition of mPGES-1 gene transcription may be one of the mechanisms by which PPARgamma regulates inflammatory responses
14871981 COX-2 and mPGES-1 are overexpressed in squamous cell carcinoma of the penis
14722058 mPGES-1 has a role in Egr-1-mediated activation of transcription in inflammatory bowel disease
14671209 mPGES, as well as COX-2, can be stimulated by cytokines, potentially contributing to increased prostaglandin production at time of infection-driven preterm labor.
14630996 Co-induction of COX-2 and mPGES in cells of the macula densa suggests that PGE(2) activates renin secretion in humans.
14558087 Enhancement of mPGES expression by PGE(2) via the EP2/EP4 receptors with an increase in cAMP may play an important role in articular inflammation in patients with rheumatoid arthritis
12860389 role for NF-kappaB in the co-ordinate induction of COX-2, mPGES and in the corresponding release of PGE2 by IL-1beta
12835322 mPGES-2 is a unique PGES that can be coupled with both COXs and may play a role in the production of the PGE2 involved in both tissue homeostasis and disease.
12818425 It appears that both the Sp1 and Sp3 proteins are important for the basal expression of PGES, mutational analysis of two Barbie-box elements in the PGES promoter showed that these were not involved in the down-regulation of PGES by phenobarbital (PB).
12721500 the expression of prostaglandin E synthase mRNA did not change with labor in full membranes or placenta
12672824 The purification, kinetics and structure of this microsomal enzyme are determined.
12664599 The microsomal, glutathione dependent enzyme is characterized.
12626523 results collectively suggest that aberrant expression of microsomal prostaglandin E synthase-1 in combination with cyclooxygenase-2 can contribute to tumorigenesis
12519887 It does NOT appear that expression of PGES is the rate-limiting step in PGE2 synthesis in fetal membranes at labor.
12512699 IL-1beta-triggered-PGE2 biosynthesis in endothelial cells is probably regulated by induction of both COX-2 and PGE-S.
12414902 no significant change in prostaglandin E synthase protein or mRNA levels at labor indicates that alterations at other points of arachidonic acid metabolism pathway may be of greater importance in affecting local changes in PGE(2)
12145315 PGES upregulates PGE2 production in human thyrocytes
9743208 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of prostaglandin E synthase (PTGES) in peptide-treated PBMCs

AA Sequence

MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLR      1 - 70
AHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASM     71 - 140
ALQILWEAARHL                                                              141 - 152
//

Text Mined References (129)

PMID Year Title
26560040 2016 Low E-prostanoid 2 receptor levels and deficient induction of the IL-1?/IL-1 type I receptor/COX-2 pathway: Vicious circle in patients with aspirin-exacerbated respiratory disease.
26538827 2015 Downregulation of mPGES-1 Expression via EGR1 Plays an Important Role in Inhibition of Caffeine on PGE2 Synthesis of HBx(+) Hepatocytes.
26498686 2015 Prostaglandins induce early growth response 1 transcription factor mediated microsomal prostaglandin E2 synthase up-regulation for colorectal cancer progression.
26113609 2015 mPGES-1 in prostate cancer controls stemness and amplifies epidermal growth factor receptor-driven oncogenicity.
25988363 2015 Relationship of the Topological Distances and Activities between mPGES-1 and COX-2 versus COX-1: Implications of the Different Post-Translational Endoplasmic Reticulum Organizations of COX-1 and COX-2.
25817443 2015 Instability of a dinucleotide repeat in the 3'-untranslated region (UTR) of the microsomal prostaglandin E synthase-1 (mPGES-1) gene in microsatellite instability-high (MSI-H) colorectal carcinoma.
25620445 2015 DNA methyltransferase inhibition accelerates the immunomodulation and migration of human mesenchymal stem cells.
25139833 2014 Prostaglandin E2 produced by inducible COX-2 and mPGES-1 promoting cancer cell proliferation in vitro and in vivo.
25108236 2014 15d-PGJ? decreases PGE? synthesis in HBx-positive liver cells by interfering EGR1 binding to mPGES-1 promoter.
24886859 2014 Lysine-specific demethylase 1-mediated demethylation of histone H3 lysine 9 contributes to interleukin 1?-induced microsomal prostaglandin E synthase 1 expression in human osteoarthritic chondrocytes.
24876670 2014 Active smoking increases microsomal PGE2-synthase-1/PGE-receptor-4 axis in human abdominal aortic aneurysms.
24771596 2015 Factors predicting outcome after salvage treatment for stage IV oral squamous cell carcinoma: Evidence of the potential importance of the cyclooxygenase-2-prostaglandin E2 pathway.
24711448 2014 Defective Tibetan PHD2 binding to p23 links high altitude adaption to altered oxygen sensing.
24133193 2013 Microvascular COX-2/mPGES-1/EP-4 axis in human abdominal aortic aneurysm.
23913682 2013 Kruppel-like factor 5 transcription factor promotes microsomal prostaglandin E2 synthase 1 gene transcription in breast cancer.
23900502 2013 Elevated expression of cyclooxygenase-2 and microsomal prostaglandin E synthase-1 in primary sclerosing cholangitis: ?mplications for cholangiocarcinogenesis.
23791007 2013 Expression of microsomal prostaglandin E2 synthase-1 and its role in human hepatocellular carcinoma.
23553915 2013 Microsomal prostaglandin E synthase-1 is induced in alzheimer's disease and its deletion mitigates alzheimer's disease-like pathology in a mouse model.
23439561 2013 NADPH oxidase NOX5-S and nuclear factor ?B1 mediate acid-induced microsomal prostaglandin E synthase-1 expression in Barrett's esophageal adenocarcinoma cells.
23431194 2013 Crystal structure of microsomal prostaglandin E2 synthase provides insight into diversity in the MAPEG superfamily.
23252918 2013 Relationship between Toll-like receptor-4 and mPGES-1 gene expression in local lesions of endometriosis patients.
22822059 2012 Cyclooxygenase-2, not microsomal prostaglandin E synthase-1, is the mechanism for interleukin-1?-induced prostaglandin E2 production and inhibition of insulin secretion in pancreatic islets.
22588264 2012 Upregulation of cyclooxygenase-2 (COX-2) and microsomal prostaglandin E2 synthase-1 (mPGES-1) in wall of ruptured human cerebral aneurysms: preliminary results.
22511203 2012 Carnosol and carnosic acids from Salvia officinalis inhibit microsomal prostaglandin E2 synthase-1.
22342541 2012 The DHEA metabolite 7?-hydroxy-epiandrosterone exerts anti-estrogenic effects on breast cancer cell lines.
22308510 2012 Interaction between head and neck squamous cell carcinoma cells and fibroblasts in the biosynthesis of PGE2.
22260630 2012 Regulation of human microsomal prostaglandin E synthase-1 by IL-1? requires a distal enhancer element with a unique role for C/EBP?.
22137787 2012 Synthesis and SAR study of imidazoquinolines as a novel structural class of microsomal prostaglandin E? synthase-1 inhibitors.
22081067 2012 EGFR signaling upregulates expression of microsomal prostaglandin E synthase-1 in cancer cells leading to enhanced tumorigenicity.
21925143 2011 Oxidized low-density lipoprotein-induced periodontal inflammation is associated with the up-regulation of cyclooxygenase-2 and microsomal prostaglandin synthase 1 in human gingival epithelial cells.
21907186 2011 Induction of human microsomal prostaglandin E synthase 1 by activated oncogene RhoA GTPase in A549 human epithelial cancer cells.
21842276 2011 Inflammatory effect of advanced glycation end products on human meniscal cells from osteoarthritic knees.
21805999 2011 Location of inhibitor binding sites in the human inducible prostaglandin E synthase, MPGES1.
21743491 2012 Microsomal prostaglandin E synthase-1 promotes hepatocarcinogenesis through activation of a novel EGR1/?-catenin signaling axis.
21645444 2011 [Role of mPGES-1 in the occurrence, progression, metastasis and invasion of hepatocellular carcinoma].
21448233 2011 Variants of gene for microsomal prostaglandin E2 synthase show association with disease and severe inflammation in rheumatoid arthritis.
21354147 2011 Microsomal prostaglandin E synthase-1 inhibits PTEN and promotes experimental cholangiocarcinogenesis and tumor progression.
21277871 2011 Tumor cells induce COX-2 and mPGES-1 expression in microvascular endothelial cells mainly by means of IL-1 receptor activation.
21277633 2011 IL-4 and IL-13 suppress prostaglandins production in human follicular dendritic cells by repressing COX-2 and mPGES-1 expression through JAK1 and STAT6.
21269460 2011 Initial characterization of the human central proteome.
21239760 2011 Valproic acid suppresses interleukin-1ß-induced microsomal prostaglandin E2 synthase-1 expression in chondrocytes through upregulation of NAB1.
21052031 2011 Identification of genetic factors associated with susceptibility to angiotensin-converting enzyme inhibitors-induced cough.
20939114 2010 mPGES-1 expression in non-cancerous liver tissue impacts on postoperative recurrence of HCC.
20635443 2010 Impacts of cytosolic phospholipase A2, 15-prostaglandin dehydrogenase, and cyclooxygenase-2 expressions on tumor progression in colorectal cancer.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20605783 2010 Identification of key residues determining species differences in inhibitor binding of microsomal prostaglandin E synthase-1.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20369883 2010 Understanding microscopic binding of human microsomal prostaglandin E synthase-1 (mPGES-1) trimer with substrate PGH2 and cofactor GSH: insights from computational alanine scanning and site-directed mutagenesis.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20086108 2010 Genetic variation in prostaglandin E2 synthesis and signaling, prostaglandin dehydrogenase, and the risk of colorectal adenoma.
20042640 2010 Hypoxia activates the cyclooxygenase-2-prostaglandin E synthase axis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19846775 2009 Microsomal prostaglandin E synthase 1 determines tumor growth in vivo of prostate and lung cancer cells.
19802674 2009 Regulation of prostaglandin E(2) synthesis in cells derived from chondrocytes of patients with osteoarthritis.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19428335 2009 Heme oxygenase-1 induction modulates microsomal prostaglandin E synthase-1 expression and prostaglandin E(2) production in osteoarthritic chondrocytes.
19412621 2009 Microsomal prostaglandin E synthase protein levels correlate with prognosis in colorectal cancer patients.
19399588 2009 COX-1 is coupled with mPGES-1 and ABCC4 in human cervix cancer cells.
19347995 2009 The terminal prostaglandin synthases mPGES-1, mPGES-2, and cPGES are all overexpressed in human gliomas.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19276290 2009 Common polymorphisms in the prostaglandin pathway genes and their association with breast cancer susceptibility and survival.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19115247 2009 HDAC4 contributes to IL-1-induced mPGES-1 expression in human synovial fibroblasts through up-regulation of Egr-1 transcriptional activity.
19114118 2009 Up-regulation of microsomal prostaglandin E synthase-1 in COX-1 and COX-2 knock-out mouse fibroblast cell lines.
19053751 2008 Pirinixic acid derivatives as novel dual inhibitors of microsomal prostaglandin E2 synthase-1 and 5-lipoxygenase.
19046748 2009 Variation in eicosanoid genes, non-fatal myocardial infarction and ischemic stroke.
19035518 2009 Association between adenomatosis polyposis coli functional status and microsomal prostaglandin E synthase-1 expression in colorectal cancer.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19017494 2008 Expression and purification of human mPGES-1 in E. coli and identification of inhibitory compounds from a drug-library.
18984580 2009 Mutation of a critical arginine in microsomal prostaglandin E synthase-1 shifts the isomerase activity to a reductase activity that converts prostaglandin H2 into prostaglandin F2alpha.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18682561 2008 Structural basis for induced formation of the inflammatory mediator prostaglandin E2.
18631945 2008 Elevated microsomal prostaglandin-E synthase-1 in Alzheimer's disease.
18555503 2008 7beta-Hydroxy-epiandrosterone-mediated regulation of the prostaglandin synthesis pathway in human peripheral blood monocytes.
18479189 2008 GPx2 counteracts PGE2 production by dampening COX-2 and mPGES-1 expression in human colon cancer cells.
18050215 2007 Hypoxia-inducible factor 1alpha is involved in the prostaglandin metabolism of osteoarthritic cartilage through up-regulation of microsomal prostaglandin E synthase 1 in articular chondrocytes.
18038187 2008 Joint effect between regular use of non-steroidal anti-inflammatory drugs, variants in inflammatory genes and risk of lymphoma.
17968936 2007 Microparticles stimulate the synthesis of prostaglandin E(2) via induction of cyclooxygenase 2 and microsomal prostaglandin E synthase 1.
17928629 2008 Nuclear factor-kappa B regulates inducible prostaglandin E synthase expression in human amnion mesenchymal cells.
17708577 Evidence that PAR2-triggered prostaglandin E2 (PGE2) formation involves the ERK-cytosolic phospholipase A2-COX-1-microsomal PGE synthase-1 cascade in human lung epithelial cells.
17707523 2007 Regulation of prostaglandin E synthases: effects of siRNA-mediated inhibition of microsomal prostaglandin E synthase-1.
17697149 2007 Prostaglandin metabolism in human hair follicle.
17696939 2007 Expression of microsomal prostaglandin E synthase-1 in human hepatocelluar carcinoma.
17680542 2007 [COX-2 and mPGES-1 expression in carotid atherosclerotic plaques].
17505022 2007 Regulation of the microsomal prostaglandin E synthase-1 in polarized mononuclear phagocytes and its constitutive expression in neutrophils.
17295901 2007 Expression of inducible microsomal prostaglandin E synthase in local lesions of endometriosis patients.
16952028 2006 Clinical implications of microsomal prostaglandin e synthase-1 overexpression in human non-small-cell lung cancer.
16891468 2006 Microsomal prostaglandin E synthase-1 regulates human glioma cell growth via prostaglandin E(2)-dependent activation of type II protein kinase A.
16598755 2006 CREB-dependent cyclooxygenase-2 and microsomal prostaglandin E synthase-1 expression is mediated by protein kinase C and calcium.
16212965 2006 Overexpression of COX-2, Prostaglandin E synthase-1 and prostaglandin E receptors in blood mononuclear cells and plaque of patients with carotid atherosclerosis: regulation by nuclear factor-kappaB.
15870920 2005 Characterization of the prostaglandin biosynthetic pathway in non-small cell lung cancer: a comparison with small cell lung cancer and correlation with angiogenesis, angiogenic factors and metastases.
15868626 2005 Expression and regulation of microsomal prostaglandin E synthase-1 in human osteoarthritic cartilage and chondrocytes.
15789615 2005 On the mechanism of biosynthesis of 19-hydroxyprostaglandins of human seminal fluid and expression of cyclooxygenase-2, PGH 19-hydroxylase (CYP4F8) and microsomal PGE synthase-1 in seminal vesicles and vas deferens.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15379214 2004 Induction of microsomal prostaglandin E synthase-1 in human gingival fibroblasts.
15234907 2004 Cigarette smoke induces cyclooxygenase-2 and microsomal prostaglandin E2 synthase in human lung fibroblasts: implications for lung inflammation and cancer.
15188353 2004 Expression of microsomal prostaglandin E synthase 1 in rheumatoid arthritis synovium.
15167446 2004 Genetic analysis of 22 candidate genes for hypertension in the Japanese population.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15023995 2004 Activation of peroxisome proliferator-activated receptor gamma inhibits interleukin-1beta-induced membrane-associated prostaglandin E2 synthase-1 expression in human synovial fibroblasts by interfering with Egr-1.
14871981 2004 Cyclooxygenase-2 and microsomal prostaglandin E synthase-1 are overexpressed in squamous cell carcinoma of the penis.
14722058 2004 Microsomal prostaglandin E synthase-1 is overexpressed in inflammatory bowel disease. Evidence for involvement of the transcription factor Egr-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14671209 2003 Differential expression and regulation of microsomal prostaglandin E(2) synthase in human fetal membranes and placenta with infection and in cultured trophoblast cells.
14630996 2004 Induction of microsomal prostaglandin E2 synthase in the macula densa in children with hypokalemic salt-losing tubulopathies.
14558087 2003 Prostaglandin E2 is an enhancer of interleukin-1beta-induced expression of membrane-associated prostaglandin E synthase in rheumatoid synovial fibroblasts.
12860389 2003 IL-1beta-dependent activation of NF-kappaB mediates PGE2 release via the expression of cyclooxygenase-2 and microsomal prostaglandin E synthase.
12835414 2003 Impaired inflammatory and pain responses in mice lacking an inducible prostaglandin E synthase.
12835322 2003 Cellular prostaglandin E2 production by membrane-bound prostaglandin E synthase-2 via both cyclooxygenases-1 and -2.
12818425 2003 Basal expression of the human MAPEG members microsomal glutathione transferase 1 and prostaglandin E synthase genes is mediated by Sp1 and Sp3.
12721500 2003 Expression of membrane prostaglandin E synthase in human placenta and fetal membranes and effect of labor.
12672824 2003 Human microsomal prostaglandin E synthase-1: purification, functional characterization, and projection structure determination.
12664599 2002 Characterization of microsomal, glutathione dependent prostaglandin E synthase.
12626523 2003 Potential role of microsomal prostaglandin E synthase-1 in tumorigenesis.
12519887 2003 Expression and localization of prostaglandin E synthase isoforms in human fetal membranes in term and preterm labor.
12512699 2002 Interleukin 1beta induces functional prostaglandin E synthase in cultured human umbilical vein endothelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12460774 2002 Purification and characterization of recombinant microsomal prostaglandin E synthase-1.
12414902 2002 Expression of prostaglandin I(2) synthase, but not prostaglandin E synthase, changes in myometrium of women at term pregnancy.
12145315 2002 Cytoplasmic prostaglandin E2 synthase is dominantly expressed in cultured KAT-50 thyrocytes, cells that express constitutive prostaglandin-endoperoxide H synthase-2. Basis for low protaglandin E2 production.
10760517 2000 Human glutathione dependent prostaglandin E synthase: gene structure and regulation.
10377395 1999 Identification of human prostaglandin E synthase: a microsomal, glutathione-dependent, inducible enzyme, constituting a potential novel drug target.
10091672 1999 Common structural features of MAPEG -- a widespread superfamily of membrane associated proteins with highly divergent functions in eicosanoid and glutathione metabolism.
9743208 1998 Increased PGE2 production mediates the in vitro inhibitory effect of the human immunodeficiency virus P24 immunosuppressive heptapeptide Ch7.
9305847 1997 A model for p53-induced apoptosis.
8253813 1993 Cloning and expression of a cDNA for the human prostaglandin E receptor EP1 subtype.
8163486 1994 Cloning, functional expression, and characterization of the human prostaglandin E2 receptor EP2 subtype.