Property Summary

Ligand Count 1,333
NCBI Gene PubMed Count 63
PubMed Score 265.91
PubTator Score 184.79

Knowledge Summary

Patent (42,938)

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-03
psoriasis -1.500 1.4e-30

Gene RIF (60)

AA Sequence

MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCRMRQTVVTTWV      1 - 70
LHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGFLLSAISLDRCLQVVRPVWAQ     71 - 140
NHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRIMCYYNVLLLNPGPDRDATCNSRQVALAVSK    141 - 210
FLLAFLVPLAIIASSHAAVSLRLQHRGRRRPGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRP    211 - 280
LVWRGLPFVTSLAFFNSVANPVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARS    281 - 350
ASPLALCSRPEEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS                             351 - 395
//

Text Mined References (69)

PMID Year Title