Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.47
PubTator Score 8.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 1.1e-06
ovarian cancer 8520 1.7e-06
osteosarcoma 7950 1.9e-06
astrocytic glioma 2597 1.6e-02
Disease Target Count Z-score Confidence
Autosomal dominant Robinow syndrome 1 15 5.129 2.6

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.200 1.6e-02
osteosarcoma -2.686 1.9e-06
ovarian cancer 2.300 1.7e-06
tuberculosis 1.400 1.1e-06

Synonym

Accession Q5JS54 C9J2F8 F8WBZ2 Q5JS53 Q5JS56 PAC-4
Symbols PAC4
C6orf86
bA506K6.2

Gene

PDB

5WTQ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGD      1 - 70
TSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF                      71 - 123
//

Text Mined References (9)

PMID Year Title