Property Summary

NCBI Gene PubMed Count 66
PubMed Score 55.89
PubTator Score 47.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.100 1.5e-02
dermatomyositis 1.100 8.4e-03
glioblastoma 1.500 6.1e-04
juvenile dermatomyositis 1.299 7.5e-17
lung cancer -1.100 1.3e-03
Multiple myeloma 1.586 1.1e-04
ovarian cancer 1.500 1.7e-03
tuberculosis 1.300 6.4e-08

 MGI Phenotype (1)

Gene RIF (37)

AA Sequence

MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVK      1 - 70
EKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIP     71 - 140
RIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYR    141 - 210
DIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY                                   211 - 249
//

Text Mined References (72)

PMID Year Title