Property Summary

NCBI Gene PubMed Count 29
PubMed Score 23.12
PubTator Score 7.72

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

PDB (15)

Gene RIF (28)

AA Sequence

MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLL      1 - 70
NKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDI     71 - 140
VFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTS    141 - 210
YELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQ    211 - 280
EMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKV    281 - 350
NEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM                                   351 - 389
//

Text Mined References (38)

PMID Year Title