Property Summary

NCBI Gene PubMed Count 28
PubMed Score 55.67
PubTator Score 38.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.230 4.0e-02
Multiple myeloma 1.411 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.300 1.8e-02
lung cancer 2.500 1.6e-05
Breast cancer 3.100 2.5e-02
group 3 medulloblastoma 1.500 3.7e-04
invasive ductal carcinoma 1.200 2.5e-03
ovarian cancer 2.400 4.6e-05

 GWAS Trait (1)

Gene RIF (7)

PMID Text
26510456 Deubiquitylase POH1 stabilizes E2F1 protein through binding to and deubiquitylating E2F1 in liver cancer.
22909820 The data demonstrated that proteasomal POH1 is a key de-ubiquitinating enzyme that regulates ubiquitin conjugates generated in response to damage and that several aspects of the DNA double-strand break response are regulated by the proteasome.
19732767 Down-regulation of PSMD14 results in decreased cell proliferation, cell cycle arrest and senescence. A comparative study with PSMB5, revealed that PSMB5 and PSMD14 have different effects on cell cycle, senescence and associated molecular events.
19419512 Disorder of POH1 expression is involved in the onset of idiopathic nephrotic syndrome (INS), and confers multidrug resistance in children with INS
19214193 Specificity for K63-linked polyubiquitin is a common property of the JAMM/MPN+ family of deubiquitinating enzymes.
17237285 An intact zinc metalloproteinase motif of Poh1 is essential for cell viability and 26S proteasome function.
16569633 Ectopic expression of POH1 in HEK293 cells decreased the level of c-Jun ubiquitination, leading to significant accumulation of the protein and a corresponding increase in AP1-mediated gene expression

AA Sequence

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVI      1 - 70
DVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERA     71 - 140
VAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKN    141 - 210
ELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDP    211 - 280
KRHLEEHVDVLMTSNIVQCLAAMLDTVVFK                                            281 - 310
//

Text Mined References (34)

PMID Year Title
26510456 2015 POH1 deubiquitylates and stabilizes E2F1 to promote tumour formation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22909820 2012 The proteasomal de-ubiquitinating enzyme POH1 promotes the double-strand DNA break response.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
19732767 2010 Knockdown of human deubiquitinase PSMD14 induces cell cycle arrest and senescence.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19419512 2009 Relationship between expression of Pad1 homologue and multidrug resistance of idiopathic nephrotic syndrome.
19349277 2009 Thioredoxin Txnl1/TRP32 is a redox-active cofactor of the 26 S proteasome.
19214193 2009 K63-specific deubiquitination by two JAMM/MPN+ complexes: BRISC-associated Brcc36 and proteasomal Poh1.
18162577 2008 Relative structural and functional roles of multiple deubiquitylating proteins associated with mammalian 26S proteasome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
17237285 2007 The JAMM motif of human deubiquitinase Poh1 is essential for cell viability.
16569633 2006 The 19 S proteasomal subunit POH1 contributes to the regulation of c-Jun ubiquitination, stability, and subcellular localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14737182 2004 JAMM: a metalloprotease-like zinc site in the proteasome and signalosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
9374539 1997 Resistance to diverse drugs and ultraviolet light conferred by overexpression of a novel human 26 S proteasome subunit.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.