Property Summary

NCBI Gene PubMed Count 105
PubMed Score 77.70
PubTator Score 96.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.9e-05
ovarian cancer 8520 8.7e-04
psoriasis 6694 1.2e-03
Multiple myeloma 1332 2.3e-03
Breast cancer 3578 2.2e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.628 1.8
Hepatocellular Adenoma 10 3.072 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 3.900 2.2e-02
Multiple myeloma 1.549 2.3e-03
osteosarcoma 2.885 2.9e-05
ovarian cancer -1.300 8.7e-04
psoriasis 1.200 1.2e-03

PDB (14)

Gene RIF (81)

AA Sequence

MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKD      1 - 70
DAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEA     71 - 140
TAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQ    141 - 210
VAKGGLGLILKRMVEG                                                          211 - 226
//

Text Mined References (107)

PMID Year Title