Property Summary

NCBI Gene PubMed Count 95
PubMed Score 49.57
PubTator Score 36.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 4.0e-05
Multiple myeloma 1327 8.3e-04
Disease Target Count Z-score Confidence
Cockayne syndrome 54 3.251 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.228 8.3e-04
ovarian cancer 2.000 4.0e-05

Gene RIF (48)

PMID Text
26592665 Our data suggest that PSMC5 facilitates the damaging effects of radiation in radiation-responsive H460 cancer cells and therefore may serve as a prognostic indicator for radiotherapy and molecular targeted therapy in lung cancer patients.
26519477 results demonstrate that PSMC5 is a new and important player involved in regulating ERK1/2 signal transmission through the remodeling of Shoc2 scaffold complex in a spatially-defined manner.
26469385 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
25739698 XopJ has protease activity to specifically degrade RPT6.
24528651 TRIP-1 regulates fibroblast acquisition of phenotype and function associated with myofibroblasts.
24482233 gamma-aminobutyric acidB receptor proteasomal degradation is mediated by the interaction of the GABAB2 C terminus with the proteasomal ATPase Rtp6 and regulated by neuronal activity
23032291 Rpt6 interacts directly with CKIP-1 and promotes the turnover of Smurf1.
22771340 Sug1 plays a critical role in transcription of MHC class I, and the MHC class II-like molecules, HLA-DM and HLA-DO.
20424172 Caspase-3 cleaves specific 19 S proteasome subunits in skeletal muscle stimulating proteasome activity
19660582 Findings show that Sug1 is crucial for regulating histone H3K4me3 and H3R17me2 at the cytokine inducible MHC-II and CIITA promoters.
19144644 SUG-1 has a unique role in linking the transcription and degradation processes via its ability to interact with SRC-3.
18854154 Knockdown of proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18662994 The current study strongly implicates the 19S ATPase Sug1 in modifying histones to initiate major histocompatibility complex class II transcription and provides novel insights into the role of the proteasome in the regulation of mammalian transcription.
18215421 These data demonstrate that both 19S and 20S subunits of the 26S proteasome play specific and critical roles in regulating CIITA activity and MHC class II transcription.
17565987 cyclic AMP-dependent protein kinase regulates proteasome function through phosphorylation of Rpt6
17302910 p45 plays an important role in regulating ataxin-3 degradation by the proteasome.
16499872 Proteasome dysfunction by a proteasome inhibitor or siRNA-mediated knock-down of Sug1 caused the up-regulation of MYO18B protein and MYO18B was polyubiquitinated in vivo.
14702340 SUG1 has a role in ubiquitin/proteasome-mediated degradation of estrogen receptors
14614829 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
14564014 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
14557625 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
14550573 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
14528301 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
14528300 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
14527406 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12970355 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12920286 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12914693 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12859895 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12840737 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12830140 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12809610 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12808466 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12808465 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12750511 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12719574 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12419264 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
12167863 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
11463857 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
10893419 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
9846577 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
9811770 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
9714759 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
9079628 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
8500623 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
8419915 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
8323548 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
2194290 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells

AA Sequence

MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQG      1 - 70
SYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMV     71 - 140
EKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCT    141 - 210
FIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQL    211 - 280
DGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAEL    281 - 350
MPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK                  351 - 406
//

Text Mined References (104)

PMID Year Title
26592665 2016 Radiosensitizing effect of PSMC5, a 19S proteasome ATPase, in H460 lung cancer cells.
26519477 2015 Spatial control of Shoc2-scaffold-mediated ERK1/2 signaling requires remodeling activity of the ATPase PSMC5.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25739698 2015 The Xanthomonas campestris type III effector XopJ proteolytically degrades proteasome subunit RPT6.
25416956 2014 A proteome-scale map of the human interactome network.
24528651 2014 TRIP-1 via AKT modulation drives lung fibroblast/myofibroblast trans-differentiation.
24482233 2014 Proteasomal degradation of ?-aminobutyric acidB receptors is mediated by the interaction of the GABAB2 C terminus with the proteasomal ATPase Rtp6 and regulated by neuronal activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23824326 2013 USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23032291 2012 CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation.
22901813 2012 Cancer vulnerabilities unveiled by genomic loss.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22771340 2012 Role of Sug1, a 19S proteasome ATPase, in the transcription of MHC I and the atypical MHC II molecules, HLA-DM and HLA-DO.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22078707 2011 TRIM5? associates with proteasomal subunits in cells while in complex with HIV-1 virions.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20424172 2010 Caspase-3 cleaves specific 19 S proteasome subunits in skeletal muscle stimulating proteasome activity.
20178748 2010 Autophosphorylated CaMKIIalpha acts as a scaffold to recruit proteasomes to dendritic spines.
19946888 2010 Defining the membrane proteome of NK cells.
19660582 The 19S proteasome positively regulates histone methylation at cytokine inducible genes.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19490896 2009 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19144644 2009 SUG-1 plays proteolytic and non-proteolytic roles in the control of retinoic acid target genes via its interaction with SRC-3.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18662994 2008 Regulation of acetylation at the major histocompatibility complex class II proximal promoter by the 19S proteasomal ATPase Sug1.
18215421 2008 The 19S proteasome ATPase Sug1 plays a critical role in regulating MHC class II transcription.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17565987 2007 Proteasome function is regulated by cyclic AMP-dependent protein kinase through phosphorylation of Rpt6.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
17302910 2007 p45, an ATPase subunit of the 19S proteasome, targets the polyglutamine disease protein ataxin-3 to the proteasome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16763564 2006 Roles for APIS and the 20S proteasome in adenovirus E1A-dependent transcription.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16499872 2006 MYO18B interacts with the proteasomal subunit Sug1 and is degraded by the ubiquitin-proteasome pathway.
16432160 2006 Inhibition of TRIP1/S8/hSug1, a component of the human 19S proteasome, enhances mitotic apoptosis induced by spindle poisons.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15885686 2005 TRIM37 defective in mulibrey nanism is a novel RING finger ubiquitin E3 ligase.
15831487 2005 Proteasomal ATPase-associated factor 1 negatively regulates proteasome activity by interacting with proteasomal ATPases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702340 2004 Involvement of suppressor for Gal 1 in the ubiquitin/proteasome-mediated degradation of estrogen receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614829 2003 The Vif protein of HIV triggers degradation of the human antiretroviral DNA deaminase APOBEC3G.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
14557625 2003 The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
14528301 2003 HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation.
14528300 2003 The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif.
14527406 2003 HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability.
12970355 2003 The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity.
12920286 2003 Virology. Weapons of mutational destruction.
12914693 2003 Death by deamination: a novel host restriction system for HIV-1.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12840737 2003 Good to CU.
12830140 2003 DNA deamination: not just a trigger for antibody diversification but also a mechanism for defense against retroviruses.
12809610 2003 DNA deamination mediates innate immunity to retroviral infection.
12808466 2003 Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts.
12808465 2003 The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12750511 2003 Hypermutation of HIV-1 DNA in the absence of the Vif protein.
12719574 2003 Comprehensive investigation of the molecular defect in vif-deficient human immunodeficiency virus type 1 virions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419264 2002 The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing.
12167863 2002 Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein.
12110588 2002 Phosphorylation by p38MAPK and recruitment of SUG-1 are required for RA-induced RAR gamma degradation and transactivation.
11463857 2001 Human immunodeficiency virus type 1 Tat binding protein-1 is a transcriptional coactivator specific for TR.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
10970867 2000 Regulation of the 26S proteasome by adenovirus E1A.
10893419 2000 Degradation of HIV-1 integrase by the N-end rule pathway.
10816420 2000 Human Sug1/p45 is involved in the proteasome-dependent degradation of Sp1.
10799514 2000 Hybrid proteasomes. Induction by interferon-gamma and contribution to ATP-dependent proteolysis.
10409732 1999 Hec1p, an evolutionarily conserved coiled-coil protein, modulates chromosome segregation through interaction with SMC proteins.
9927201 1999 Adenovirus early region 1A protein binds to mammalian SUG1-a regulatory component of the proteasome.
9846577 1998 Evidence for a newly discovered cellular anti-HIV-1 phenotype.
9811770 1998 An endogenous inhibitor of human immunodeficiency virus in human lymphocytes is overcome by the viral Vif protein.
9714759 1998 Cloning and heterogeneous in vivo expression of Tat binding protein-1 (TBP-1) in the mouse.
9473509 1998 Chromosomal localization and immunological analysis of a family of human 26S proteasomal ATPases.
9464850 1997 Purification and characterization of 26S proteasomes from human and mouse spermatozoa.
9295362 1997 HEC binds to the seventh regulatory subunit of the 26 S proteasome and modulates the proteolysis of mitotic cyclins.
9173976 1997 The XPB subunit of repair/transcription factor TFIIH directly interacts with SUG1, a subunit of the 26S proteasome and putative transcription factor.
9110174 1997 Large-scale concatenation cDNA sequencing.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
9048938 1997 Localization of genes encoding two human one-domain members of the AAA family: PSMC5 (the thyroid hormone receptor-interacting protein, TRIP1) and PSMC3 (the Tat-binding protein, TBP1).
8811196 1996 Structure and functions of the 20S and 26S proteasomes.
8710853 1996 Mammalian Sug1 and c-Fos in the nuclear 26S proteasome.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8598193 1996 Differential ligand-dependent interactions between the AF-2 activating domain of nuclear receptors and the putative transcriptional intermediary factors mSUG1 and TIF1.
8500623 1993 Peptide sequencing identifies MSS1, a modulator of HIV Tat-mediated transactivation, as subunit 7 of the 26 S protease.
8419915 1993 The type 1 human immunodeficiency virus Tat binding protein is a transcriptional activator belonging to an additional family of evolutionarily conserved genes.
8323548 1993 Molecular cloning and developmental regulation of Dictyostelium discoideum homologues of the human and yeast HIV1 Tat-binding protein.
7870181 1995 Interaction of thyroid-hormone receptor with a conserved transcriptional mediator.
7776974 1995 Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor.
7729537 1995 cDNA cloning of a new putative ATPase subunit p45 of the human 26S proteasome, a homolog of yeast transcriptional factor Sug1p.
2194290 1990 A cDNA for a protein that interacts with the human immunodeficiency virus Tat transactivator.
1429620 1992 Subunit 4 of the 26 S protease is a member of a novel eukaryotic ATPase family.