Property Summary

NCBI Gene PubMed Count 82
PubMed Score 373.96
PubTator Score 284.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Multiple myeloma 1.288 6.3e-04
Barrett's esophagus 1.200 2.1e-02
esophageal adenocarcinoma 2.100 1.8e-02
cutaneous lupus erythematosus 2.100 8.0e-04
psoriasis 2.600 2.1e-04
astrocytoma 1.400 8.7e-12
glioblastoma 2.500 9.1e-05
oligodendroglioma 1.100 8.2e-09
posterior fossa group A ependymoma 2.200 1.0e-09
medulloblastoma, large-cell -1.500 2.0e-03
juvenile dermatomyositis 2.763 5.1e-14
chronic kidney disease 1.500 1.4e-02
tuberculosis 1.400 4.4e-05
primary pancreatic ductal adenocarcinoma 1.116 4.0e-03
lung cancer -3.300 1.3e-05
active Crohn's disease 2.767 4.7e-04
ulcerative colitis 2.200 1.8e-08
pancreatic cancer 1.200 2.8e-03
interstitial cystitis 2.000 2.0e-03
pediatric high grade glioma 1.700 4.3e-04
pilocytic astrocytoma 2.100 7.7e-09
primary Sjogren syndrome 2.300 8.0e-04
subependymal giant cell astrocytoma 1.868 1.4e-02
lung carcinoma -2.000 9.9e-16
ovarian cancer 2.200 9.2e-04
dermatomyositis 2.500 4.6e-03

Gene RIF (83)

PMID Text
25548428 The TAP1-rs1135216 and PSMB9-rs17587 variants are significantly associated with vitiligo, and even one copy of these mutant alleles can influence the risk among Saudis.
25098831 Comparison with reference profiles of sorted immune cells and healthy muscle confirmed upregulation of PSMB8 and -9 in myositis biopsies beyond infiltration related changes.
24809174 The data show that LMP2 and PSMA6 gene polymorphism is not a risk factor of ischemic stroke in Ukrainian population.
24377540 study found prevalence of LMP2-AA genotype was higher in acute myeolid leukemia (AML) patients while it was significantly lower in multiple myeloma (MM) cases than in the control subjects; results suggestLMP2 polymorphisms could play a role in the development of AML and MM
24040045 Data indicate that the codon 60 Arg/His polymorphism does not significantly alter the expression and activity of beta1i among the cell lines tested and clinical samples from colon and pancreatic cancer.
23568741 Genetic polymorphisms of rs17587 of PSMB9 appeared to be associated with rheumatoid arthritis in ethnic Han Chinese from Yunnan.
23360169 functional variants in PSMB9 may contribute to melanoma susceptibility.
23018640 Data indicate that treatment-emergent resistance to single-agent bortezomib was independent of variants in the proteasome genes PSMB1, PSMB5, PSMB6, PSMB8, PSMB9, and PSMB10.
22944692 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
22925930 The MAGE-C(2336-344) antigenic peptide is produced by the immunoproteasome and intermediate proteasome beta1i-beta5i, but not by the standard proteasome nor intermediate proteasome beta5i.
22705098 study reports expression of LMP2 in patients with renal oncocytomas (RO) and eosinophilic variant of chromophobe renal cell carcinomas (CHRCC-EO); all CHRCC-EO cases (7 of 7) strongly showed nuclear LMP2 staining, as opposed to only 2 of 56 ROs; suggest its use as an aid in differential diagnosis of these neoplasias
22659265 LMP2 may negatively regulate LMS independently of its role in the proteasome.
22355695 LMP2 has a role as a tumor-suppressor and may have a role in uterine leiomyosarcoma therapy
22287277 LMP2 expression in nasopharyngeal carcinoma is associated with poor prognosis.
22261389 The polymorphic site is unique in the Chinese population of Han nationality at the LMP2 codon 60 loci (Arg60Cys), but a lack of association with lung cancer exists.
22041443 High expression of LMP2 and low expression of PPM1A might play an important role in the motility and invasiveness of trophoblast cells and malignant transformation of hydatidiform mole.
22034108 This is the first study to demonstrate that LMP2 variants can affect radiographic severity in ankylosing spondylitis.
21529441 In patients with primary Sjogren's syndrome, the expression of LMP7 (but not LMP2) is up-regulated in the labial gland.
21303409 the genetic variant within the LMP2/LMP7 gene would increase the risk of intestinal M. tuberculosis infection.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20525414 Observational study of gene-disease association. (HuGE Navigator)
20470844 In a southern Spanish population, no differences were observed in the frequencies of the LMP and TAP genotypes between brucellosis patients and controls.
20470844 Observational study of gene-disease association. (HuGE Navigator)
20300807 downregulation of expression in PBMC of chronic hepatitis B patients
20174631 Data show that LMP2 60HH variant reduces the risk to develop MS amongst Italian HLA-A*02+ females.
20174631 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20153157 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19833746 data show that the proteasomal ss1i subunit is dysregulated in peripheral white blood cells and in inflammatory infiltrates of minor salivary glands in patients with Sjogren's syndrome
19526842 Obtained data suggest the LMP2 and PSMA6 gene polymorphism significance as the risk factors of essential hypertension in adolescents.
19526842 Observational study of gene-disease association. (HuGE Navigator)
19404951 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19202550 Observational study of gene-disease association. (HuGE Navigator)
19148137 Downregulation of LMP2 is associated with acute myeloid leukaemic blasts.
18694960 These data reveal a novel "feed-forward" mechanism induced by NF-kappaB which ensures that acutely synthesized IRF-1 operates in concert with NF-kappaB to amplify the immunoproteasome and antigen-processing functions of CD40.
18248301 Observational study of gene-disease association. (HuGE Navigator)
17581627 Observational study of gene-disease association. (HuGE Navigator)
17581627 study found strong associations of psoriasis with variant alleles of LMP and TAP
17491658 Observational study of gene-disease association. (HuGE Navigator)
17142736 two inducible subunits of the proteasome, lmp2 and lmp7, are transcriptionally up-regulated by heat shock; heat-shocked cells show enhanced presentation of immunoproteasome-dependent MHC I antigenic epitopes, but not immunoproteasome-independent epitopes
16957778 LMP2-associated proteasome is recruited to the entire sequence of ER target genes, implicating a role for the proteasome in both transcription initiation and elongation.
16703666 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
16512786 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
16396320 Observational study of gene-disease association. (HuGE Navigator)
16224524 Observational study of gene-disease association. (HuGE Navigator)
16222703 These data suggest that LMP2 contributes to IkappaBalpha degradation and p50 generation, and that inhibition of LMP2 suppresses expression and activities of MMP-2 and MMP-9 by blocking the transfer of active NF-kappaB heterodimers into the nucleus.
15686587 Observational study of gene-disease association. (HuGE Navigator)
15603870 Observational study of gene-disease association. (HuGE Navigator)
15284441 caspase inhibition led to elevated levels of LMP2 and oxidized proteins; results suggest an age-related loss in capacity to carry out apoptosis might contribute to the observed accumulation of oxidized proteins during aging and in age-related diseases.
14614829 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
14564014 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
14557625 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
14550573 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
14528301 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
14528300 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
14527406 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12970355 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12920286 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12914693 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12859895 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12840737 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12830140 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12809610 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12808466 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12808465 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12750511 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12719574 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12648225 Observational study of gene-disease association. (HuGE Navigator)
12519221 Impaired expression of proteasome subunits is involved in the loss of HLA class I expression in human colon cancer cells.
12419264 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
12225333 Observational study of gene-disease association. (HuGE Navigator)
12209365 Observational study of genotype prevalence. (HuGE Navigator)
12167863 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
11819535 Observational study of gene-disease association. (HuGE Navigator)
11788900 a high-frequency TAP1/LMP2 promoter polymorphism in human tumors
11775239 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11772516 Observational study of gene-disease association. (HuGE Navigator)
11737038 Observational study of gene-disease association. (HuGE Navigator)
10893419 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
9846577 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
9811770 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
9079628 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease

AA Sequence

MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAA      1 - 70
DAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLT     71 - 140
RQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILG    141 - 210
NELPKFYDE                                                                 211 - 219
//

Text Mined References (92)

PMID Year Title
26524591 2015 Additive loss-of-function proteasome subunit mutations in CANDLE/PRAAS patients promote type I IFN production.
25548428 2014 Transporter TAP1-637G and immunoproteasome PSMB9-60H variants influence the risk of developing vitiligo in the Saudi population.
25098831 2014 Upregulation of immunoproteasome subunits in myositis indicates active inflammation with involvement of antigen presenting cells, CD8 T-cells and IFN?.
24809174 2014 [Frequency of allele polymorphism of immune proteasome catalytic subunits in patients with ischemic stroke].
24377540 2013 Association of an LMP2 polymorphism with acute myeloid leukemia and multiple myeloma.
24040045 2013 PSMB9 codon 60 polymorphisms have no impact on the activity of the immunoproteasome catalytic subunit B1i expressed in multiple types of solid cancer.
23568741 2013 [Association between polymorphisms of PSMB8, PSMB9 and TAP2 genes with rheumatoid arthritis in ethnic Han Chinese from Yunnan].
23360169 2013 Association between putative functional variants in the PSMB9 gene and risk of melanoma--re-analysis of published melanoma genome-wide association studies.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23018640 2012 Sequence analysis of ?-subunit genes of the 20S proteasome in patients with relapsed multiple myeloma treated with bortezomib or dexamethasone.
22993228 2013 Novel genetic variants associated with lumbar disc degeneration in northern Europeans: a meta-analysis of 4600 subjects.
22925930 2012 Analysis of the processing of seven human tumor antigens by intermediate proteasomes.
22705098 2013 LMP2, a novel immunohistochemical marker to distinguish renal oncocytoma from the eosinophilic variant of chromophobe renal cell carcinoma.
22659265 2012 Potential role of LMP2 as an anti-oncogenic factor in human uterine leiomyosarcoma: morphological significance of calponin h1.
22355695 2011 Potential role of LMP2 as tumor-suppressor defines new targets for uterine leiomyosarcoma therapy.
22287277 2012 Clinical significance of elevated spleen tyrosine kinase expression in nasopharyngeal carcinoma.
22261389 2012 Lack of association between the unique LMP2 gene polymorphism and the outcome of lung cancer in a population of Chinese Han nationality.
22041443 2011 [Expression and significance of LMP2 and PPM1A in gestational trophoblastic disease].
22034108 2012 Radiographic severity of ankylosing spondylitis is associated with polymorphism of the large multifunctional peptidase 2 gene in the Spondyloarthritis Research Consortium of Canada cohort.
21529441 2011 Expression of proteasome immunosubunit in labial glands of patients with primary Sjogren's syndrome.
21399633 2011 Genome-wide association study identifies susceptibility loci for IgA nephropathy.
21303409 2011 LMP2/LMP7 gene variant: a risk factor for intestinal Mycobacterium tuberculosis infection in the Chinese population.
21269460 2011 Initial characterization of the human central proteome.
20723761 2010 Immunoproteasomes preserve protein homeostasis upon interferon-induced oxidative stress.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20525414 2011 Genetic variation in the LMP/TAP gene and outcomes of hepatitis B virus infection in the Chinese population.
20470844 2010 No association of TAP and LMP genetic polymorphism in human brucellosis and its complications.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20300807 2010 Impaired antigen processing and presentation machinery is associated with immunotolerant state in chronic hepatitis B virus infection.
20174631 2010 Immunoproteasome LMP2 60HH variant alters MBP epitope generation and reduces the risk to develop multiple sclerosis in Italian female population.
20153157 2010 PSMB8 (LMP7) but not PSMB9 (LMP2) gene polymorphisms are associated to pigeon breeder's hypersensitivity pneumonitis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19833746 2009 Expression of proteasomal immunosubunit beta1i is dysregulated in inflammatory infiltrates of minor salivary glands in Sjogren's syndrome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19526842 2009 [Allele polymorphism of genes coding proteasome subunits is associated with an enhanced risk for arterial hypertension in adolescents].
19404951 2009 Association of a specific ERAP1/ARTS1 haplotype with disease susceptibility in ankylosing spondylitis.
19202550 2009 Single nucleotide polymorphisms in antigen processing machinery component ERAP1 significantly associate with clinical outcome in cervical carcinoma.
19148137 2009 In situ analysis of the antigen-processing machinery in acute myeloid leukaemic blasts by tissue microarray.
18985028 2008 Hepatitis C virus infection protein network.
18694960 2008 CD40 induces antigen transporter and immunoproteasome gene expression in carcinomas via the coordinated action of NF-kappaB and of NF-kappaB-mediated de novo synthesis of IRF-1.
18248301 2008 Variation in HLA class I antigen-processing genes and susceptibility to human papillomavirus type 16-associated cervical cancer.
17581627 2007 Strong associations of psoriasis with antigen processing LMP and transport genes TAP differ by gender and phenotype.
17491658 2005 Genetic susceptibility to type 1 diabetes in the intracellular pathway of antigen processing - a subject review and cross-study comparison.
17262812 2007 Genome-wide gene expression differences in Crohn's disease and ulcerative colitis from endoscopic pinch biopsies: insights into distinctive pathogenesis.
17142736 2006 Heat shock up-regulates lmp2 and lmp7 and enhances presentation of immunoproteasome-dependent epitopes.
16957778 2006 The catalytic subunit of the proteasome is engaged in the entire process of estrogen receptor-regulated transcription.
16396320 [The frequency of allelic polymorphism of genes encoding immunoproteasome catalytic subunits in acute coronary syndrome patients].
16224524 2005 [Association between LMP2/LMP7 gene polymorphism and the infection of hepatitis B virus].
16222703 2006 Proteasome subunit LMP2 is required for matrix metalloproteinase-2 and -9 expression and activities in human invasive extravillous trophoblast cell line.
15907481 2005 IRF-1 mediates upregulation of LMP7 by IFN-gamma and concerted expression of immunosubunits of the proteasome.
15686587 2005 Polymorphisms of transporter associated with antigen processing type 1 (TAP1), proteasome subunit beta type 9 (PSMB9) and their common promoter in African children with different manifestations of malaria.
15603870 2004 Association study of LMP gene polymorphisms in Mexican patients with spondyloarthritis.
15501285 2004 Potential effects of tetrodotoxin exposure to human glial cells postulated using microarray approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15284441 2004 Inhibition of apoptosis in acute promyelocytic leukemia cells leads to increases in levels of oxidized protein and LMP2 immunoproteasome.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14733938 2004 Protein-protein interactions among human 20S proteasome subunits and proteassemblin.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12648225 2003 Association of TAP and HLA-DM genes with psoriasis in Koreans.
12519221 2003 Impaired expression of proteasome subunits and human leukocyte antigens class I in human colon cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12225333 2002 A single nucleotide polymorphism of the low molecular mass polypeptide 7 gene influences the interferon response in patients with chronic hepatitis C.
12209365 2002 LMP2 and LMP7 gene polymorphism in Mexican populations: Mestizos and Amerindians.
11819535 2000 The relationship of lmp2 and DR3 genes with susceptibility to type I diabetes mellitus in south China Han population.
11788900 2002 High frequency of a non-functional TAP1/LMP2 promoter polymorphism in human tumors.
11775239 2000 Polymorphisms of TAP, LMP and HLA-DM genes in the Chinese.
11772516 Age dependent impact of LMP polymorphisms on TNFalpha-induced apoptosis in human peripheral blood mononuclear cells.
11737038 2001 Distribution of HLA-A, B alleles and polymorphisms of TAP and LMP genes in Korean patients with atopic dermatitis.
11717192 2001 Bipartite regulation of different components of the MHC class I antigen-processing machinery during dendritic cell maturation.
11493458 2001 Tumor necrosis factor-alpha induces coordinated changes in major histocompatibility class I presentation pathway, resulting in increased stability of class I complexes at the cell surface.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
10924276 2000 Complex association analysis of graves disease using a set of polymorphic markers.
10329130 1999 Sequence information within proteasomal prosequences mediates efficient integration of beta-subunits into the 20 S proteasome complex.
9367687 1997 DNA sequence, chromosomal localization, and tissue expression of the mouse proteasome subunit lmp10 (Psmb10) gene.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
9003765 1996 Analysis of mammalian 20S proteasome biogenesis: the maturation of beta-subunits is an ordered two-step mechanism involving autocatalysis.
8811196 1996 Structure and functions of the 20S and 26S proteasomes.
8666937 1996 Newly identified pair of proteasomal subunits regulated reciprocally by interferon gamma.
8663318 1996 Proteasome subunits X and Y alter peptidase activities in opposite ways to the interferon-gamma-induced subunits LMP2 and LMP7.
8568858 1996 Evolutionary dynamics of non-coding sequences within the class II region of the human MHC.
8458375 1993 The major histocompatibility complex-encoded proteasome component LMP7: alternative first exons and post-translational processing.
8163024 1994 Replacement of proteasome subunits X and Y by LMP7 and LMP2 induced by interferon-gamma for acquirement of the functional diversity responsible for antigen processing.
7829535 1995 Major histocompatibility-encoded human proteasome LMP2. Genomic organization and a new form of mRNA.
7811265 1994 Human proteasome subunits from 2-dimensional gels identified by partial sequencing.
1922385 1991 Second proteasome-related gene in the human MHC class II region.
1681432 1991 Homology of proteasome subunits to a major histocompatibility complex-linked LMP gene.
1529427 1992 Nomenclature for factors of the HLA system, 1991. WHO Nomenclature Committee for factors of the HLA system.
1453454 1992 DNA sequence analysis of 66 kb of the human MHC class II region encoding a cluster of genes for antigen processing.
1429565 1992 Alternative exon usage and processing of the major histocompatibility complex-encoded proteasome subunits.