Property Summary

NCBI Gene PubMed Count 54
PubMed Score 6.67
PubTator Score 3.85

Knowledge Summary

Patent

No data available

Expression

 Compartment GO Term (0)

AA Sequence

MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVA      1 - 70
DKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAA     71 - 140
LVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDL    141 - 210
GSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS       211 - 277
//