Property Summary

NCBI Gene PubMed Count 54
PubMed Score 6.67
PubTator Score 3.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 1.3e-02
ependymoma 1.200 3.0e-02
hepatocellular carcinoma -1.200 1.4e-02
intraductal papillary-mucinous adenoma (... 1.700 5.8e-04
intraductal papillary-mucinous carcinoma... 2.100 2.4e-04
intraductal papillary-mucinous neoplasm ... 1.700 6.4e-03
Multiple myeloma 2.006 2.7e-04
oligodendroglioma 1.200 1.3e-02
ovarian cancer 2.100 1.1e-04
Pick disease 1.300 3.7e-07
Waldenstrons macroglobulinemia 1.160 1.8e-02

PDB (23)

Gene RIF (32)

AA Sequence

MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVA      1 - 70
DKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAA     71 - 140
LVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDL    141 - 210
GSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS       211 - 277
//

Text Mined References (67)

PMID Year Title