Property Summary

NCBI Gene PubMed Count 57
PubMed Score 13.72
PubTator Score 13.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.479 1.1e-02
Multiple myeloma 2.055 8.6e-04
psoriasis -2.000 2.3e-05
lung cancer 1.100 1.5e-03
non primary Sjogren syndrome sicca 1.300 4.5e-02
ovarian cancer 2.000 9.0e-04

Gene RIF (34)

PMID Text
25656574 Taken together, our results demonstrated that PSMB4 regulated MM cell growth in part by activating NF-kappaB-miR-21 signaling, which may represent promising targets for novel specific therapies.
24291262 Data indicate that recruitment of proteasomes into mutant huntingtin (mHTT) protein initiated inclusion bodies (IBs) was observed when the PSMB4-GFP was co-expressed with mHTT.
23559827 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
23026050 proteasome subunit beta type 4 (PSMB4), the beta7 subunit of the 20S core complex, was identified as a direct binding partner of CRBN.
20810900 While 26 proteasome dysfunction is observed in Parkinson's disease (PD), diverse mutations in the parkin gene are linked to early-onset autosomal-recessive forms of familial PD.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
18504423 Observational study of gene-disease association. (HuGE Navigator)
14614829 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
14564014 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
14557625 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
14550573 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
14528301 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
14528300 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
14527406 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12970355 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12920286 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12914693 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12859895 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12840737 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12830140 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12809610 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12808466 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12808465 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12750511 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12719574 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12419264 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
12167863 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
10893419 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
9846577 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
9811770 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
9344905 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
9079628 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells

AA Sequence

MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAAD      1 - 70
MLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRA     71 - 140
MYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEA    141 - 210
RDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE                    211 - 264
//

Text Mined References (71)

PMID Year Title
26524591 2015 Additive loss-of-function proteasome subunit mutations in CANDLE/PRAAS patients promote type I IFN production.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25656574 2015 PSMB4 promotes multiple myeloma cell growth by activating NF-?B-miR-21 signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24291262 2014 Dynamic recruitment of active proteasomes into polyglutamine initiated inclusion bodies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23026050 2012 Cereblon inhibits proteasome activity by binding to the 20S core proteasome subunit beta type 4.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20810900 2010 Parkin directly modulates 26S proteasome activity.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18504423 2008 Polymorphisms in inflammation-related genes are associated with susceptibility to major depression and antidepressant response.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17367606 2007 Fibrolamellar carcinomas show overexpression of genes in the RAS, MAPK, PIK3, and xenobiotic degradation pathways.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15660529 2005 Interaction of U-box E3 ligase SNEV with PSMB4, the beta7 subunit of the 20 S proteasome.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614829 2003 The Vif protein of HIV triggers degradation of the human antiretroviral DNA deaminase APOBEC3G.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
14557625 2003 The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
14528301 2003 HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation.
14528300 2003 The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif.
14527406 2003 HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability.
12970355 2003 The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity.
12920286 2003 Virology. Weapons of mutational destruction.
12914693 2003 Death by deamination: a novel host restriction system for HIV-1.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12840737 2003 Good to CU.
12830140 2003 DNA deamination: not just a trigger for antibody diversification but also a mechanism for defense against retroviruses.
12809610 2003 DNA deamination mediates innate immunity to retroviral infection.
12808466 2003 Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts.
12808465 2003 The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12750511 2003 Hypermutation of HIV-1 DNA in the absence of the Vif protein.
12719574 2003 Comprehensive investigation of the molecular defect in vif-deficient human immunodeficiency virus type 1 virions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419264 2002 The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing.
12167863 2002 Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein.
12097147 2002 A novel link between the proteasome pathway and the signal transduction pathway of the bone morphogenetic proteins (BMPs).
11571290 2001 Proteasomal degradation of Smad1 induced by bone morphogenetic proteins.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
11205743 2001 Polo-like kinase interacts with proteasomes and regulates their activity.
10893419 2000 Degradation of HIV-1 integrase by the N-end rule pathway.
10436176 1999 The complete primary structure of mouse 20S proteasomes.
9846577 1998 Evidence for a newly discovered cellular anti-HIV-1 phenotype.
9811770 1998 An endogenous inhibitor of human immunodeficiency virus in human lymphocytes is overcome by the viral Vif protein.
9344905 1997 HsN3 proteasomal subunit as a target for human immunodeficiency virus type 1 Nef protein.
9344661 1997 Genetic relationships of the genes encoding the human proteasome beta subunits and the proteasome PA28 complex.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
8811196 1996 Structure and functions of the 20S and 26S proteasomes.
8692272 1996 Effects on NF-kappa B1/p105 processing of the interaction between the HTLV-1 transactivator Tax and the proteasome.
8013624 1994 Cloning and expression of a human pro(tea)some beta-subunit cDNA: a homologue of the yeast PRE4-subunit essential for peptidylglutamyl-peptide hydrolase activity.
7918633 1994 Sequence analyses and inter-species comparisons of three novel human proteasomal subunits, HsN3, HsC7-I and HsC10-II, confine potential proteolytic active-site residues.
7811265 1994 Human proteasome subunits from 2-dimensional gels identified by partial sequencing.
2306472 1990 Relationships among the subunits of the high molecular weight proteinase, macropain (proteasome).
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.