Property Summary

Ligand Count 32
NCBI Gene PubMed Count 41
PubMed Score 17.25
PubTator Score 12.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer 1.500 4.2e-02
dermatomyositis 1.300 1.8e-04
glioblastoma 1.200 8.4e-03
Multiple myeloma 1.963 8.8e-06
ovarian cancer -1.500 9.9e-05
pancreatic ductal adenocarcinoma liver m... -1.357 3.2e-02
Waldenstrons macroglobulinemia 1.260 2.7e-03

PDB (48)

Gene RIF (32)

AA Sequence

MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPK      1 - 70
CYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGG     71 - 140
LDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISA    141 - 210
AERDVYTGDALRICIVTKEGIREETVSLRKD                                           211 - 241
//

Text Mined References (57)

PMID Year Title