Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.26
PubTator Score 4.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.200 1.0e-02
pancreatic cancer 1.500 3.2e-03
oligodendroglioma 1.100 1.8e-11
posterior fossa group B ependymoma 1.400 2.9e-07
non-small cell lung cancer 1.013 8.1e-10
pilocytic astrocytoma 1.200 6.6e-05
pancreatic carcinoma 1.500 3.2e-03
invasive ductal carcinoma -1.700 3.0e-04
lung carcinoma 1.900 2.1e-27
Breast cancer -1.400 1.9e-03
acute myeloid leukemia -2.200 4.4e-02

Gene RIF (4)

PMID Text
25456346 We found evidence for PRTFDC1 as a potential novel PTSD gene, a finding that awaits further replication.
21818316 These results demonstrate that PRTFDC1 is a genetic modifier of HPRT-deficiency in the mouse.
21054786 The PRTFDC1 structure has been determined at 1.7 A resolution with bound GMP. The overall structure and GMP binding mode are very similar to that observed for HPRT.
17599052 epigenetic silencing of PRTFDC1 by hypermethylation of the CpG island leads to a loss of PRTFDC1 function, which might be involved in squamous cell oral carcinogenesis.

AA Sequence

MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIM      1 - 70
VLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIV     71 - 140
EDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLN    141 - 210
HICVINEHGKEKYRV                                                           211 - 225
//

Text Mined References (17)

PMID Year Title
25456346 2015 Genomic predictors of combat stress vulnerability and resilience in U.S. Marines: A genome-wide association study across multiple ancestries implicates PRTFDC1 as a potential PTSD gene.
25416956 2014 A proteome-scale map of the human interactome network.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21818316 2011 PRTFDC1 is a genetic modifier of HPRT-deficiency in the mouse.
21054786 2010 Structural and functional studies of the human phosphoribosyltransferase domain containing protein 1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17599052 2007 PRTFDC1, a possible tumor-suppressor gene, is frequently silenced in oral squamous-cell carcinomas by aberrant promoter hypermethylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16928426 2007 Gene duplication and inactivation in the HPRT gene family.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.