Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.78
PubTator Score 5.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 3.300 6.1e-129
medulloblastoma, large-cell -1.100 1.0e-04
breast carcinoma 1.100 4.8e-04
cystic fibrosis 1.200 4.1e-04
group 4 medulloblastoma -1.100 2.6e-04
lung adenocarcinoma 1.700 1.5e-09

Synonym

Accession Q9GZN4 O43342 Q6UXE0 BSSP-4
Symbols BSSP-4
SP001LA
hBSSP-4

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
24980078 Our findings collectively support a potential role of T3 in cancer cell progression through regulation of the BSSP4 protease via the ERK 1/2-C/EBPbeta-VEGF cascade
16176265 prosemin is a novel serine protease of the chromosome 16 cluster that is highly expressed in the pancreas.
15701722 Tryptase epsilon also was able to induce pro-uPA-expressing smooth muscle cells to increase their migration

AA Sequence

MVVSGAPPALGGGCLGTFTSLLLLASTAILNAARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKN      1 - 70
GTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACA     71 - 140
DIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSH    141 - 210
LYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSA    211 - 280
HRSWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARS                                     281 - 317
//

Text Mined References (9)

PMID Year Title
24980078 2014 Thyroid hormone enhanced human hepatoma cell motility involves brain-specific serine protease 4 activation via ERK signaling.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16176265 2005 A novel serine protease highly expressed in the pancreas is expressed in various kinds of cancer cells.
15701722 2005 Urokinase-type plasminogen activator is a preferred substrate of the human epithelium serine protease tryptase epsilon/PRSS22.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11602603 2001 Human tryptase epsilon (PRSS22), a new member of the chromosome 16p13.3 family of human serine proteases expressed in airway epithelial cells.