Property Summary

Ligand Count 793
NCBI Gene PubMed Count 169
PubMed Score 548.09
PubTator Score 404.64

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (136)

AA Sequence

MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQ      1 - 70
VRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCL     71 - 140
ISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQL    141 - 210
QGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS                                     211 - 247
//

Text Mined References (172)

PMID Year Title