Property Summary

NCBI Gene PubMed Count 6
PubMed Score 14.37
PubTator Score 2.94

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Arts syndrome 6 5.253 2.6
Gout 93 4.248 2.1
Hyperuricemia 35 3.942 2.0

Gene RIF (2)

21734401 Data indicate taht candidate genes ACTB, BZW, OCM, MACC1, NXPH1, PRPS1L1, RAC1 and RPA3, which lie within the DFNB90 region, were sequenced and no potentially causal variants were identified.
2168892 Translation initiates from a non-AUG (ACG) start codon.

AA Sequence

MKHCSKIRVIDISMILAEAIRRTHNGESVSYLFSHVPL                                    281 - 318

Text Mined References (7)

PMID Year Title
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
21734401 2011 Novel autosomal recessive nonsyndromic hearing impairment locus DFNB90 maps to 7p22.1-p15.3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
2168892 1990 A human testis-specific mRNA for phosphoribosylpyrophosphate synthetase that initiates from a non-AUG codon.
1314091 1992 Promoter regions of the human X-linked housekeeping genes PRPS1 and PRPS2 encoding phosphoribosylpyrophosphate synthetase subunit I and II isoforms.