Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.83
PubTator Score 9.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -2.759 8.0e-07
medulloblastoma, large-cell 1.800 7.5e-04
non-small cell lung cancer 2.156 5.7e-13
intraductal papillary-mucinous neoplasm ... 2.300 5.3e-04
pancreatic cancer 1.300 9.8e-03
fibroadenoma 1.400 3.0e-02
interstitial cystitis -3.100 7.4e-04
lung adenocarcinoma 1.400 5.1e-15
atypical teratoid/rhabdoid tumor 1.100 1.2e-05
spina bifida -1.339 8.1e-03
ductal carcinoma in situ 2.900 2.0e-03
invasive ductal carcinoma 2.600 9.6e-03
ovarian cancer 3.200 3.1e-05

 GO Function (1)

Gene RIF (6)

PMID Text
23583380 Prom2 protrusions primarily localize to lipid rafts and recruit cholesterol into protrusions and away from caveolae, leading to increased phosphorylation of caveolin-1, which inhibits Cdc42-dependent endocytosis
20333396 Data show the distribution and subcellular localization of prominin-2 within the kidney in situ and its release into the urine.
19724856 prominin-2, another protein in the same family as CD133/prominin-1, may not play an important functional role in the growth of human glioma and hepatocellular carcinoma cells
18536929 Prominin-2 is widely and abundantly expressed along the epithelia of various segments of the adult male genitourinary tract.
17145811 The PROM2 gene was shown to effectively separate these two tumor(chromophobe renal cell carcinoma (RCC) and benign oncocytoma) groups by quantitative reverse transcription-PCR using fresh tissue samples, with similar trends seen on formalin-fixed tissues.
12514187 identification as well as molecular and cell biological characterization

AA Sequence

MKHTLALLAPLLGLGLGLALSQLAAGATDCKFLGPAEHLTFTPAARARWLAPRVRAPGLLDSLYGTVRRF      1 - 70
LSVVQLNPFPSELVKALLNELASVKVNEVVRYEAGYVVCAVIAGLYLLLVPTAGLCFCCCRCHRRCGGRV     71 - 140
KTEHKALACERAALMVFLLLTTLLLLIGVVCAFVTNQRTHEQMGPSIEAMPETLLSLWGLVSDVPQELQA    141 - 210
VAQQFSLPQEQVSEELDGVGVSIGSAIHTQLRSSVYPLLAAVGSLGQVLQVSVHHLQTLNATVVELQAGQ    211 - 280
QDLEPAIREHRDRLLELLQEARCQGDCAGALSWARTLELGADFSQVPSVDHVLHQLKGVPEANFSSMVQE    281 - 350
ENSTFNALPALAAMQTSSVVQELKKAVAQQPEGVRTLAEGFPGLEAASRWAQALQEVEESSRPYLQEVQR    351 - 420
YETYRWIVGCVLCSVVLFVVLCNLLGLNLGIWGLSARDDPSHPEAKGEAGARFLMAGVGLSFLFAAPLIL    421 - 490
LVFATFLVGGNVQTLVCQSWENGELFEFADTPGNLPPSMNLSQLLGLRKNISIHQAYQQCKEGAALWTVL    491 - 560
QLNDSYDLEEHLDINQYTNKLRQELQSLKVDTQSLDLLSSAARRDLEALQSSGLQRIHYPDFLVQIQRPV    561 - 630
VKTSMEQLAQELQGLAQAQDNSVLGQRLQEEAQGLRNLHQEKVVPQQSLVAKLNLSVRALESSAPNLQLE    631 - 700
TSDVLANVTYLKGELPAWAARILRNVSECFLAREMGYFSQYVAWVREEVTQRIATCQPLSGALDNSRVIL    701 - 770
CDMMADPWNAFWFCLAWCTFFLIPSIIFAVKTSKYFRPIRKRLSSTSSEETQLFHIPRVTSLKL          771 - 834
//

Text Mined References (20)

PMID Year Title
23583380 2013 Prominin-2 expression increases protrusions, decreases caveolae and inhibits Cdc42 dependent fluid phase endocytosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20333396 2010 Prominin-2 is a novel marker of distal tubules and collecting ducts of the human and murine kidney.
19724856 2009 Effect of CD133/prominin-1 antisense oligodeoxynucleotide on in vitro growth characteristics of Huh-7 human hepatocarcinoma cells and U251 human glioma cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18536929 2008 Robust expression of Prominin-2 all along the adult male reproductive system and urinary bladder.
17874118 2007 Differential expression of Prominin-1 (CD133) and Prominin-2 in major cephalic exocrine glands of adult mice.
17145811 2006 Gene expression profiling separates chromophobe renal cell carcinoma from oncocytoma and identifies vesicular transport and cell junction proteins as differentially expressed genes.
16673119 2006 An ultrastructural and immunohistochemical study of a combined submucosal granular cell tumor and lipoma of the colon showing a unique nodule-in-nodule structure: putative implication of CD34 or prominin-2-positive stromal cells in its histopathogenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12514187 2003 Characterization of prominin-2, a new member of the prominin family of pentaspan membrane glycoproteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446606 2002 Identification and characterization of a novel testosterone-regulated prominin-like gene in the rat ventral prostate.