Property Summary

NCBI Gene PubMed Count 18
PubMed Score 16.35
PubTator Score 11.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.000 2.8e-03
posterior fossa group A ependymoma -2.100 1.4e-11
oligodendroglioma -1.500 1.0e-02
glioblastoma -2.600 4.4e-10
sonic hedgehog group medulloblastoma -1.800 1.6e-03
atypical teratoid / rhabdoid tumor -2.600 7.9e-14
medulloblastoma, large-cell -1.300 4.8e-02
primitive neuroectodermal tumor -1.600 1.7e-03
pediatric high grade glioma -2.200 1.7e-08
pilocytic astrocytoma -2.400 7.2e-10
subependymal giant cell astrocytoma -1.494 4.4e-02
lung carcinoma 1.600 2.6e-19
Alzheimer's disease -1.100 3.2e-02
Pick disease -1.300 1.0e-03

Gene RIF (10)

PMID Text
26876602 Biochemical, biophysical and mutagenesis experiments demonstrated that hPRMT8 forms an octamer in solution.
23946480 automethylation of the N terminus likely regulates PRMT8 activity by decreasing the affinity of the enzyme for AdoMet
23635657 Mutational defects in PRMT8 is not the cause of frontotemporal lobar degeneration.
23620769 wild type FUS (FUS-WT) specifically interacts with protein arginine methyltransferases 1 and 8 (PRMT1 and PRMT8) and undergoes asymmetric dimethylation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19060911 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18698489 EWS is a substrate for PRMT8, as efficient as for PRMT1
18320585 The interaction between PRMT8 and the EWS protein was charcterized.
17925405 PRMT8 N-terminal domain may function as an autoregulator that may be displaced by interaction with one or more physiological inducers.
16051612 PRMT8 is an active arginine methyltransferase that is membrane-associated and tissue-specific

AA Sequence

MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEM      1 - 70
TSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGI     71 - 140
ECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKP    141 - 210
GGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDI    211 - 280
YTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRR    281 - 350
GEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR                              351 - 394
//

Text Mined References (19)

PMID Year Title
26876602 2016 Novel helical assembly in arginine methyltransferase 8.
25416956 2014 A proteome-scale map of the human interactome network.
23946480 2013 Automethylation of protein arginine methyltransferase 8 (PRMT8) regulates activity by impeding S-adenosylmethionine sensitivity.
23635657 2013 Mutations in protein N-arginine methyltransferases are not the cause of FTLD-FUS.
23620769 2013 Protein arginine methyltransferase 1 and 8 interact with FUS to modify its sub-cellular distribution and toxicity in vitro and in vivo.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060904 2009 An empirical framework for binary interactome mapping.
18698489 2008 EWS is a substrate of type I protein arginine methyltransferase, PRMT8.
18320585 2008 Identification of proteins interacting with protein arginine methyltransferase 8: the Ewing sarcoma (EWS) protein binds independent of its methylation state.
17925405 2007 Regulation of protein arginine methyltransferase 8 (PRMT8) activity by its N-terminal domain.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16051612 2005 PRMT8, a new membrane-bound tissue-specific member of the protein arginine methyltransferase family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.