Property Summary

NCBI Gene PubMed Count 48
PubMed Score 44.54
PubTator Score 46.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
hepatocellular carcinoma 1.200 1.9e-04
osteosarcoma 1.143 9.2e-03
atypical teratoid / rhabdoid tumor 1.400 1.1e-04
sonic hedgehog group medulloblastoma 1.200 3.4e-03
medulloblastoma, large-cell 1.600 3.6e-03
primitive neuroectodermal tumor 1.100 4.5e-03
pilocytic astrocytoma 1.100 1.3e-03

Gene RIF (42)

PMID Text
26848759 PRMT6 influences PRC-mediated gene silencing at the rostral HOXA genes locus.
26690413 PRMT6, which was down-regulated by androgen receptors and influenced cell migration and apoptosis of germ cells, could play a potentially important role in spermatogenesis.
26611710 Data show that HIV-1 Tat methylation by protein arginine methyltransferase 6 (PRMT6) can inhibit nucleolar retention.
26436589 PRMT6 methylates tumor cell p21 at arginine 156 and promotes phosphorylation of threonine 145 on p21, increasing the cytoplasmic localization of p21 and inducing resistance to anticancer drugs.
26178996 N terminus is methylated by PRMT6 and that this critically affects the functions of pUL69 for efficient mRNA export and replication of human cytomegalovirus.
26070566 TBL1 is required to protect GPS2 from degradation, with methylation of GPS2 by arginine methyltransferase PRMT6 regulating the interaction with TBL1 and inhibiting proteasome-dependent degradation.
25481537 PRMT6 mediates cigarette smoke extract induced apoptosis and inflammation through H3R2me2a in HUVECs.
24742914 PRMT6 specifically interacts with ERalpha at its ligand-binding domain.
23980157 Arginine 42 of histone H3 (H3R42), is dimethylated by the methyltransferases coactivator arginine methyltransferase 1 (CARM1) and protein arginine methyltransferase 6 (PRMT6) in vitro and in vivo.
23911394 Data show arginine methyltransferase PRMT6 methylates the AT-hook motif of regulatory factor RFX5 and downregulates HLA-DQ expression.
23866860 These results show that PRMT6 automethylation plays a role in the stability of this protein and that this event is indispensible for its anti-HIV-1 activity.
23866860 PRMT6 mutant V86K/D88A fails to methylate HIV-1 Rev. PRMT6 is automethylated at position R35, which regulates its stability and is necessary for its HIV-1 restriction activity
23800116 Authors show that PRMT6 requires the activation domain, but surprisingly not the basic domain, of HIV-1 Tat for protein interaction.
23800116 PRMT6 mutant V86K/D88A fails to methylate HIV-1 Rev. PRMT6 is automethylated at position R35, which regulates its stability and is necessary for its HIV-1 restriction activity
23380452 these data demonstrate that PRMT6 overexpression is associated with regulation of motility and invasion through up-regulation of TSP-1 and down-regulation of MMPs in human cancer cells.
23326497 36 new putative partners for PRMT6 were identified.
23265702 Findings indicate that expression of PRMT4/CARM1 and PRMT6 is deregulated in melanoma.
23032699 Specific arginine residues of p16 protein are methylated by PRMT6 which may be critical for the activity of p16.
22916108 Gene expression and promoter analysis show that p21 and p27 are direct targets of PRMT6, which involves methylation of arginine-2 of histone H3. Our findings imply arginine methylation of histones by PRMT6 in cell cycle regulation
22777353 PRMT6 is recruited by RUNX1 and mediates asymmetric histone H3 arginine-2 dimethylation (H3R2me2a) at megakaryocytic genes in progenitor cells.
22673335 dysregulation of PRMT6-dependent transcription and alternative splicing may be involved in breast cancer pathophysiology and the molecular consequences identifying a unique and informative biomarker profile.
22219200 the molecular mechanisms of PRMT catalysis
22077140 PRMT6 mutant V86K/D88A fails to methylate HIV-1 Rev. PRMT6 is automethylated at position R35, which regulates its stability and is necessary for its HIV-1 restriction activity
21204735 PRMT6 mutant V86K/D88A fails to methylate HIV-1 Rev. PRMT6 is automethylated at position R35, which regulates its stability and is necessary for its HIV-1 restriction activity
20812326 In this study, we use Forster resonance energy transfer (FRET) to determine dissociation constant (K(D)) values for dimerization of PRMT1 and PRMT6.
20473859 PRMT6 may be involved in human carcinogenesis and may thus be a therapeutic target for various types of cancer.
19754311 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19726520 PRMT6 mutant V86K/D88A fails to methylate HIV-1 Rev. PRMT6 is automethylated at position R35, which regulates its stability and is necessary for its HIV-1 restriction activity
19509293 TSP-1 is a transcriptional repression target of PRMT6
18976462 PRMT6 mutant V86K/D88A fails to methylate HIV-1 Rev. PRMT6 is automethylated at position R35, which regulates its stability and is necessary for its HIV-1 restriction activity
18508616 PRMT6 mutant V86K/D88A fails to methylate HIV-1 Rev. PRMT6 is automethylated at position R35, which regulates its stability and is necessary for its HIV-1 restriction activity
18079182 findings identify PRMT6 as the mammalian methyltransferase for H3 R2 and establish the enzyme as a crucial negative regulator of H3 K4 trimethylation and transcriptional activation
18077460 PRMT6 methylates H3R2 and is a negative regulator of N-terminal H3 tail binding
17898714 the arginine methyltransferase PRMT6 catalyses H3R2 di-methylation in vitro and controls global levels of H3R2me2a in vivo
17415034 PRMT6 mutant V86K/D88A fails to methylate HIV-1 Rev. PRMT6 is automethylated at position R35, which regulates its stability and is necessary for its HIV-1 restriction activity
17267505 findings show HIV-1 Tat is a specific substrate of PRMT6 which targets Tat R52 & R53 residues for arginine methylation; PRMT6 can compromise Tat transcriptional activation & may represent a form of innate cellular immunity in regard to HIV-1 replication
17267505 PRMT6 mutant V86K/D88A fails to methylate HIV-1 Rev. PRMT6 is automethylated at position R35, which regulates its stability and is necessary for its HIV-1 restriction activity
17176473 severely impairs the function of HIV-1 Rev binding to and export of viral RNA
17176473 PRMT6 mutant V86K/D88A fails to methylate HIV-1 Rev. PRMT6 is automethylated at position R35, which regulates its stability and is necessary for its HIV-1 restriction activity
17169163 PRMT6 mutant V86K/D88A fails to methylate HIV-1 Rev. PRMT6 is automethylated at position R35, which regulates its stability and is necessary for its HIV-1 restriction activity
15596808 methylates HIV-1 Tat protein and acts as a restriction factor for HIV-1 replication
15596808 PRMT6 mutant V86K/D88A fails to methylate HIV-1 Rev. PRMT6 is automethylated at position R35, which regulates its stability and is necessary for its HIV-1 restriction activity

AA Sequence

MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAY      1 - 70
RLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPV     71 - 140
ETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQ    141 - 210
VKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCY    211 - 280
GSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNP    281 - 350
RRLRVLLRYKVGDQEEKTKDFAMED                                                 351 - 375
//

Text Mined References (58)

PMID Year Title
26848759 2016 The Arginine Methyltransferase PRMT6 Cooperates with Polycomb Proteins in Regulating HOXA Gene Expression.
26690413 2015 Protein Arginine Methyltransferase 6 Involved in Germ Cell Viability during Spermatogenesis and Down-Regulated by the Androgen Receptor.
26611710 2016 The protein arginine methyltransferase PRMT6 inhibits HIV-1 Tat nucleolar retention.
26436589 2015 PRMT6 increases cytoplasmic localization of p21CDKN1A in cancer cells through arginine methylation and makes more resistant to cytotoxic agents.
26178996 2015 pUL69 of Human Cytomegalovirus Recruits the Cellular Protein Arginine Methyltransferase 6 via a Domain That Is Crucial for mRNA Export and Efficient Viral Replication.
26070566 2015 Exchange Factor TBL1 and Arginine Methyltransferase PRMT6 Cooperate in Protecting G Protein Pathway Suppressor 2 (GPS2) from Proteasomal Degradation.
25481537 2015 PRMT6 mediates CSE induced inflammation and apoptosis.
25416956 2014 A proteome-scale map of the human interactome network.
24742914 2014 Protein arginine methyltransferase 6 enhances ligand-dependent and -independent activity of estrogen receptor ? via distinct mechanisms.
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
23980157 2013 H3R42me2a is a histone modification with positive transcriptional effects.
23911394 2013 Differential regulation of MHCII genes by PRMT6, via an AT-hook motif of RFX5.
23866860 2013 Automethylation of protein arginine methyltransferase 6 (PRMT6) regulates its stability and its anti-HIV-1 activity.
23800116 2013 Overexpression of PRMT6 does not suppress HIV-1 Tat transactivation in cells naturally lacking PRMT6.
23563609 2013 Genome-wide SNP and CNV analysis identifies common and low-frequency variants associated with severe early-onset obesity.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23380452 2013 PRMT6 overexpression upregulates TSP-1 and downregulates MMPs: its implication in motility and invasion.
23326497 2013 Identification and characterization of new molecular partners for the protein arginine methyltransferase 6 (PRMT6).
23265702 2013 Deregulation of protein methylation in melanoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23032699 2012 Suppression of PRMT6-mediated arginine methylation of p16 protein potentiates its ability to arrest A549 cell proliferation.
22916108 2012 Cell cycle regulation by the PRMT6 arginine methyltransferase through repression of cyclin-dependent kinase inhibitors.
22829776 2012 A genome-wide association meta-analysis of circulating sex hormone-binding globulin reveals multiple Loci implicated in sex steroid hormone regulation.
22777353 2013 Histone arginine methylation keeps RUNX1 target genes in an intermediate state.
22673335 2012 Protein arginine methyltransferase 6-dependent gene expression and splicing: association with breast cancer outcomes.
22449649 2012 Genome-wide association study of intelligence: additive effects of novel brain expressed genes.
22219200 2012 Kinetic mechanism of protein arginine methyltransferase 6 (PRMT6).
22197933 2011 A genome-wide association study in Chinese men identifies three risk loci for non-obstructive azoospermia.
21269460 2011 Initial characterization of the human central proteome.
20812326 2010 Förster resonance energy transfer measurements of cofactor-dependent effects on protein arginine N-methyltransferase homodimerization.
20473859 2011 Dysregulation of PRMT1 and PRMT6, Type I arginine methyltransferases, is involved in various types of human cancers.
20047962 2010 Protein arginine methyltransferase 6 regulates multiple aspects of gene expression.
19754311 2009 Genomewide association study of a rapid progression cohort identifies new susceptibility alleles for AIDS (ANRS Genomewide Association Study 03).
19509293 2009 Thrombospondin-1 is a transcriptional repression target of PRMT6.
19405910 2009 Kinetic analysis of human protein arginine N-methyltransferase 2: formation of monomethyl- and asymmetric dimethyl-arginine residues on histone H4.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18263580 2008 A kinetic study of human protein arginine N-methyltransferase 6 reveals a distributive mechanism.
18079182 2007 PRMT6-mediated methylation of R2 in histone H3 antagonizes H3 K4 trimethylation.
18077460 2008 Arginine methylation of the histone H3 tail impedes effector binding.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17898714 2007 Methylation of histone H3R2 by PRMT6 and H3K4 by an MLL complex are mutually exclusive.
17415034 2007 Arginine methylation of the HIV-1 nucleocapsid protein results in its diminished function.
17267505 2007 Arginine methylation of the human immunodeficiency virus type 1 Tat protein by PRMT6 negatively affects Tat Interactions with both cyclin T1 and the Tat transactivation region.
17176473 2006 PRMT6 diminishes HIV-1 Rev binding to and export of viral RNA.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16600869 2006 Arginine methylation regulates DNA polymerase beta.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16293633 2006 The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6.
16159886 2005 Dynamics of human protein arginine methyltransferase 1(PRMT1) in vivo.
16157300 2005 Protein arginine methyltransferase 6 specifically methylates the nonhistone chromatin protein HMGA1a.
15596808 2005 Methylation of Tat by PRMT6 regulates human immunodeficiency virus type 1 gene expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334060 2004 DAL-1/4.1B tumor suppressor interacts with protein arginine N-methyltransferase 3 (PRMT3) and inhibits its ability to methylate substrates in vitro and in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
11724789 2002 The novel human protein arginine N-methyltransferase PRMT6 is a nuclear enzyme displaying unique substrate specificity.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.