Property Summary

NCBI Gene PubMed Count 121
PubMed Score 144.75
PubTator Score 128.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.145 5.9e-03
ependymoma 1.300 6.7e-03
oligodendroglioma 1.200 5.6e-03
psoriasis 1.100 4.4e-04
osteosarcoma -1.511 3.2e-05
medulloblastoma, large-cell 1.200 1.6e-04
non-small cell lung cancer 1.104 1.1e-17
lung cancer 1.900 6.2e-05
group 3 medulloblastoma 1.100 5.4e-04
non primary Sjogren syndrome sicca 1.400 1.9e-02
spina bifida -1.702 3.6e-02
ovarian cancer 2.000 1.2e-03

Protein-protein Interaction (7)

Gene RIF (85)

PMID Text
26912361 methylthioadenosine accumulation in 5-methylthioadenosine phosphorylase-deleted cancers creates a hypomorphic PRMT5 state that is selectively sensitized toward further PRMT5 inhibition.
26912360 these findings reveal PRMT5 as a potential vulnerability across multiple cancer lineages augmented by a common "passenger" genomic alteration.
26763441 PRMT5 gene is silencing gene expression by histone arginine methylation in keratinocytes.
26759235 PRMT5-induced methylation prevented phosphorylation of SREBP1a on S430 by GSK3beta
26729154 PRMT5 expression was upregulated during HTLV-1-mediated T-cell transformation.
26708443 Our results indicate that PRMT5 is a marker of poor prognosis in NPC patients. PRMT5 promoted the radioresistance of NPC cells via targeting FGFR3, at least partly if not totally.
26658161 Data show that the E3 ubiquitin ligase CHIP interacts with protein arginine methyltransferase-5 (PRMT5) both in vivo and in vitro.
26597461 UHRF1 could form a complex with PRMT5 to contribute to the endometrial carcinogenesis.
26563484 Data show that Omomyc protein co-localized with proto-oncogene protein c-myc (c-Myc), protein arginine methyltransferase 5 (PRMT5) and histone H4 H4R3me2s-enriched chromatin domains.
26554819 arginine residues within the third intracellular loop of the D2 dopamine receptor were methylated by protein arginine methyltransferase 5 (PRMT5)
26541651 PRMT5 plays an important role in human hepatocellular carcinoma growth via the downregulation of beta-catenin
26536822 Increased PRMT5 activity enhanced acute myeloid leukemia growth.
26482848 PRMT5 co-localizes with RASSF1A on stabilized microtubules.RASSF1A promotes the translocation of cytosolic PRMT5 to microtubules.
26248553 high nuclear expression of Protein arginine methyltransferase-5 is a potentially useful marker for estimating submucosal invasion of early colorectal carcinomas in endoscopically resected specimens
26151339 The novel PRMT5S likely contributes to the observed diverse effects of PRMT5 in cells.
26086249 PRMT5 is down-regulated by beta-amyloid in primary neurons and SH-SY5Y cells. This up-regulates E2F-1. PRMT5 knockdown in SH-SY5Y cells over-expressing the Swedish mutant form of human amyloid-beta precursor protein caused activation of apoptotic pathways.
26078354 Findings provide new evidence that PRMT5 plays an important role in CRC pathogenesis through epigenetically regulating arginine methylation of oncogenes such as eIF4E and FGFR3.
26069323 PRMT5 role in the U snRNP assembly machinery
25927346 PRMT5- mediated symmetric arginine dimethylation is attenuated by mutant huntingtin and is impaired in Huntington's disease.
25870105 The G tract-mediated exon skipping creates a shorter PRMT5 protein (PRMT5S) that exhibits distinct localization and promotes cell cycle arrest at interphase.
25742700 Data indicate that protein arginine methyltransferase 5 (PRMT5) is overexpressed in Epstein-Barr virus (EBV)+ primary lymphomas, EBV-transformed and EBV-immortalized B cells.
25721668 PRMT5 enhances transcriptional activity of constitutive androstane receptor.PRMT5 is a gene-selective co-activator for CAR.
25713080 Data indicate that MEP50 WD repeat protein is essential for methylation of histones H4 and H2A by PRMT5 arginine methyltransferase.
25704480 TRAF4 upregulated PRMT5 expression, which occurred predominantly in the nucleus, on which TRAF4 promotion of cell proliferation in breast cancer is mainly dependent.
25582697 PRMT5 is required for lymphomagenesis triggered by multiple oncogenic drivers
25485739 data confirm that MEP50 plays a key role in substrate recognition and activates PRMT5 activity by increasing its affinity for protein substrates.
25475372 These studies implicate PRMT5 in a novel mode of MYCN post-translational regulation.
25457166 PRMT5 is directly involved in genome defense during preimplantation development and in primordial germ cells at the time of global DNA demethylation.
25324546 PRMT5-mediated repression represents a novel mechanism of negative regulation of Cyp24a1.
25281873 The PKC-c-Fos-NF-Y signaling pathway may be responsible for PRMT5 overexpression in a subset of human cancer patients.
25234597 Based on these results, we propose that PRMT5 determines cell fate by regulating 5'-cap dependent translation of proteins essential for proliferation and survival.
25220593 Our data suggest that LCE1 is a novel p53 downstream target that can be directly transactivated by p53 and is likely to have tumor suppressor functions through modulation of the PRMT5 activity.
25012667 findings indicate that PRMT5 is an essential regulator of myocardial hypertrophic signaling and suggest that strategies aimed at activating PRMT5 in the heart may represent a potential therapeutic approach for the prevention of cardiac hypertrophy
24753255 We found that depletion of PRMT5 results in significantly reduced levels of CXCL10 mRNA, demonstrating a positive role for PRMT5 in CXCL10 induction.
24664369 The results of this study indicated that PRMT5 is a marker of malignant progression in glioma tumors and plays a pivotal role in tumor growth.
24477620 PRMT5 functions in human embryonic stem cels to regulate proliferation in the self-renewing state by regulating the fraction of cells in Gap 1 (G1) of the cell cycle.
24453002 The tumor suppressor ST7 is a key gene silenced by PRMT5.
24326178 PRMT5 is significantly overexpressed in neoplastic lung tissues supporting its role in lung tumorigenesis.
24189068 PRMT5 knockdown in non-Hodgkin lymphoma cell lines and primary lymphoma cells leads to RBL2 derepression and RB1 reactivation, which in turn inhibit PRC2 expression.
24121109 These results demonstrate that PRMT1 and PRMT5 are involved in hypoxia and ischemia-induced apoptosis via p-p38 MAPK and p-JNK in in vitro and in vivo models.
24098663 PRMT5 is upregulated in malignant and metastatic melanoma and regulates expression of MITF and p27(Kip1.).
23912080 results show that protein arginine methyl transferase (PRMT)-3 and -5 methylate NaV1.5 in vitro, interact with NaV1.5 in human embryonic kidney (HEK) cells, and increase NaV1.5 current density
23904475 PRMT5 dimethylates R30 of the p65 subunit to activate NF-kappaB.
23671120 PRMT5 modulates the metabolic response to fasting signals.
23292799 These results suggest that overexpression of PRMT5 correlates with an aggressive malignant phenotype and may constitute a novel prognostic factor for epithelial ovarian cancer.
23261437 PRMT5 triggers the symmetric dimethylation of EBNA2 RG domain to coordinate with EBNA2-mediated transcription.
23133559 type II protein arginine methyltransferase 5 has a role in the regulation of Circadian Per1 and CRY1 genes
23071334 structure of the surprising hetero-octameric complex reveals the close interaction between the seven-bladed beta-propeller MEP50 and the N-terminal domain of PRMT5, and delineates the structural elements of substrate recognition.
22952863 These results imply a novel mechanism by which PRMT5 controls cell growth and contributes to prostate tumorigenesis.
22726390 Protein arginine methyltransferase 5 is a potential oncoprotein that upregulates G1 cyclins/cyclin-dependent kinases and the phosphoinositide 3-kinase/AKT signaling cascade.
22708516 Data suggest that PRMT5 is highly expressed in lung cancer cells; PRMT5 expression is not detectable in benign lung tissues. Silencing PRMT5 expression strongly inhibits proliferation of lung adenocarcinoma cells in culture and in a xenograft model.
22269951 HOXA9 is required for TNF-alpha-dependent binding of PRMT5 to the E-selectin promoter in endothelial cells.
22266372 PRMT5 probably promotes tumor growth by stimulating cell proliferation and by participating in the construction of a tumor-favorable microenvironment via HIF-1 activation.
22231400 Here the authors report that H3R2 is also symmetrically dimethylated (H3R2me2s) by PRMT5 and PRMT7 and present in euchromatic regions.
22199349 PRMT5 inhibits the PKCdelta- or 12-O-tetradecanoylphorbol-13-acetate-dependent increase in human involucrin expression, and PRMT5 dimethylates proteins in the p38delta complex.
22143770 analysis of structural insights into protein arginine symmetric dimethylation by PRMT5
21975038 The results not only provide insight into the molecular mechanisms by which PRMT5 contributes to growth control, but also justify therapeutic targeting of PRMT5.
21917714 Protein arginine methyltransferase 5 regulates ERK1/2 signal transduction amplitude and cell fate through CRAF.
21700716 results reveal a new cofactor for PDCD4 that alters its tumor suppressor functions and point to the utility of PDCD4/PRMT5 status as both a prognostic biomarker and a potential target for chemotherapy
21592330 COX2-dependent and independent activation of CK2alpha-Akt/uPA signal is mainly involved in urothelial carcinoma cell survival
21316606 results indicate that phosphorylation of PRMT5 contributes to the mutant JAK2-induced myeloproliferative phenotype
21262773 The activity of SHP is also increased by posttranslational methylation at Arg-57 by protein arginine methyltransferase 5 (PRMT5).
21159818 loss of Prmt5 function is early embryonic-lethal due to the abrogation of pluripotent cells in blastocysts
21081503 RioK1, a new interactor of protein arginine methyltransferase 5 (PRMT5), competes with pICln for binding and modulates PRMT5 complex composition and substrate specificity.
20951943 Increased PRMT5 activity mediates key events associated with cyclin D1-dependent neoplastic growth, including CUL4 repression, CDT1 overexpression, and DNA rereplication.
20495075 PRMT5 induces multiprotein repressor complex containing the histone modifying enzymes SUV4-20h1, casein kinase 2alpha in silencing fetal globin gene expression resulting in beta-thalassemia and sickle cell disease.
20421892 The protein arginine methyltransferase 5 (PRMT5) localizes to the GA and forms complexes with several components involved in GA ribbon formation and vesicle tethering.
19741270 ZNF224 recruits the arginine methyltransferase PRMT5 on the transcriptional repressor complex of the aldolase A gene
19234465 Loss of the H4 arginine 3 methylation mark through short hairpin RNA-mediated knockdown of PRMT5 leads to reduced DNMT3A binding, loss of DNA methylation and gene activation.
19086919 FGF-2 is a new substrate of PRMT5.
19032343 These results indicate that Ski complexes serve to maintain a TGF-beta-responsive promoter at a repressed basal level via the activities of histone deacetylase and histone arginine methyltransferase.
18992153 BLIMP1 and PRMT5 were expressed and arginine dimethylation of histones H2A and H4 was detected in human male gonocytes and intratubular germ cell neoplasia unclassified and most seminomas, while downregulated in embryonal carcinoma.
18694959 These results indicate that PRMT5 overexpression epigenetically alters the transcription of key tumor suppressor genes.
18347060 identification of the protein arginine methyltransferase 5 (PRMT5) as an effector recruited to SNAIL through an interaction with AJUBA that functions to repress the SNAIL target gene, E-cadherin
17709427 that in human cells, PRMT5 and PRMT7 are required for Sm protein sDMA modification, and that Sm protein symmetric dimethylarginine modification is required for snRNP biogenesis in human cells.
17627275 aberrant expression of PRMT5 leads to altered epigenetic modification of chromatin, which in turn impacts transcriptional performance of anti-cancer genes and growth of transformed lymphoid cells
17437848 results suggest distinct functions of the nuclear and the p44/protein arginine methyltransferase 5 complexes in the developing fetal testis and in the oncogenesis of testicular tumors.
16712789 SUZ12 might have a role in transcriptional regulation through physical interaction with MEP50 that can be an adaptor between PRMT5 and its substrate H2A
16087681 Lsm10 and Lsm11, which replace the Sm proteins D1 and D2 in the histone RNA processing U7 snRNPs, associate with pICln in vitro and in vivo without receiving sDMA modifications and with PRMT5 and SMN complexes
15737618 contrast to PRMT3, DAL-1/4.1B was found to mediate PRMT5 by either inhibiting (Sm proteins) or enhancing (myelin basic protein) protein methylation.
15701830 Up-regulation of SKB1 is associated with gastric cancer
15670829 found that FCP1 is a genuine substrate of PRMT5-methylation both in vivo and in vitro, and FCP1-associated PRMT5 can methylate histones H4 in vitro
15654770 It was found that is the recruitment of methylarginine-specific protein(s) to cytokine promoter regions that regulates their gene expression.
15485929 suppressor of tumorigenicity 7 (ST7) and nonmetastatic 23 (NM23) are direct targets of PRMT5-containing BRG1 and hBRM complexes
14559996 Data show that PRMT5 can be found in association with hSWI/SNF complexes and is involved in regulating the expression of carbamoyl-phosphate synthase-aspartate carbamoyltransferase-dihydroorotase.

AA Sequence

MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSD      1 - 70
LLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTN     71 - 140
HIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGA    141 - 210
DLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSY    211 - 280
LQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVP    281 - 350
EEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM    351 - 420
REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREK    421 - 490
DRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLY    491 - 560
QDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTG    561 - 630
RSYTIGL                                                                   631 - 637
//

Text Mined References (130)

PMID Year Title
26912361 2016 Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
26912360 2016 MTAP deletion confers enhanced dependency on the PRMT5 arginine methyltransferase in cancer cells.
26763441 2016 MEP50/PRMT5 Reduces Gene Expression by Histone Arginine Methylation and this Is Reversed by PKC?/p38? Signaling.
26759235 2016 Arginine Methylation of SREBP1a via PRMT5 Promotes De Novo Lipogenesis and Tumor Growth.
26729154 2015 PRMT5 Is Upregulated in HTLV-1-Mediated T-Cell Transformation and Selective Inhibition Alters Viral Gene Expression and Infected Cell Survival.
26708443 2016 Protein N-arginine methyltransferase 5 promotes the tumor progression and radioresistance of nasopharyngeal carcinoma.
26700805 2016 SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination.
26658161 2016 The E3 ubiquitin ligase CHIP mediates ubiquitination and proteasomal degradation of PRMT5.
26597461 2016 Methylation of tumor suppressor gene CDH13 and SHP1 promoters and their epigenetic regulation by the UHRF1/PRMT5 complex in endometrial carcinoma.
26563484 2015 Myc and Omomyc functionally associate with the Protein Arginine Methyltransferase 5 (PRMT5) in glioblastoma cells.
26554819 2015 The protein arginine methyltransferase PRMT5 promotes D2-like dopamine receptor signaling.
26541651 2015 Targeting protein arginine methyltransferase 5 inhibits human hepatocellular carcinoma growth via the downregulation of beta-catenin.
26536822 2016 The dual epigenetic role of PRMT5 in acute myeloid leukemia: gene activation and repression via histone arginine methylation.
26482848 2015 Identification of protein arginine N-methyltransferase 5 (PRMT5) as a novel interacting protein with the tumor suppressor protein RASSF1A.
26248553 2015 High nuclear expression of protein arginine methyltransferase-5 is a potentially useful marker to estimate submucosal invasion in endoscopically resected early colorectal carcinoma.
26151339 2015 Differential expression, distinct localization and opposite effect on Golgi structure and cell differentiation by a novel splice variant of human PRMT5.
26086249 2015 The protein arginine methyltransferase PRMT5 regulates A?-induced toxicity in human cells and Caenorhabditis elegans models of Alzheimer's disease.
26078354 2015 Targeting protein arginine methyltransferase 5 inhibits colorectal cancer growth by decreasing arginine methylation of eIF4E and FGFR3.
26069323 2015 Reconstitution of the human U snRNP assembly machinery reveals stepwise Sm protein organization.
25927346 2015 PRMT5- mediated symmetric arginine dimethylation is attenuated by mutant huntingtin and is impaired in Huntington's disease (HD).
25870105 2015 Evolutionary emergence of a novel splice variant with an opposite effect on the cell cycle.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25742700 2015 Selective inhibition of protein arginine methyltransferase 5 blocks initiation and maintenance of B-cell transformation.
25721668 2015 Protein arginine methyltransferase 5 (PRMT5) is a novel coactivator of constitutive androstane receptor (CAR).
25713080 2015 Histone H2A and H4 N-terminal tails are positioned by the MEP50 WD repeat protein for efficient methylation by the PRMT5 arginine methyltransferase.
25704480 2015 Proliferative role of TRAF4 in breast cancer by upregulating PRMT5 nuclear expression.
25582697 2015 PRMT5 is required for lymphomagenesis triggered by multiple oncogenic drivers.
25485739 2014 Protein arginine methyltransferase 5 catalyzes substrate dimethylation in a distributive fashion.
25475372 2015 Protein arginine methyltransferase 5 is a key regulator of the MYCN oncoprotein in neuroblastoma cells.
25457166 2014 PRMT5 protects genomic integrity during global DNA demethylation in primordial germ cells and preimplantation embryos.
25324546 2014 Novel mechanism of negative regulation of 1,25-dihydroxyvitamin D3-induced 25-hydroxyvitamin D3 24-hydroxylase (Cyp24a1) Transcription: epigenetic modification involving cross-talk between protein-arginine methyltransferase 5 and the SWI/SNF complex.
25284789 2014 5-Hydroxymethylcytosine plays a critical role in glioblastomagenesis by recruiting the CHTOP-methylosome complex.
25281873 2014 Transcriptional activation of PRMT5 by NF-Y is required for cell growth and negatively regulated by the PKC/c-Fos signaling in prostate cancer cells.
25234597 2014 PRMT5 is essential for the eIF4E-mediated 5'-cap dependent translation.
25220593 2014 Late Cornified Envelope Group I, a novel target of p53, regulates PRMT5 activity.
25012667 2014 Inhibition of cardiomyocyte hypertrophy by protein arginine methyltransferase 5.
24753255 2014 Tumor necrosis factor (TNF)-? induction of CXCL10 in endothelial cells requires protein arginine methyltransferase 5 (PRMT5)-mediated nuclear factor (NF)-?B p65 methylation.
24664369 2014 Expression of PRMT5 correlates with malignant grade in gliomas and plays a pivotal role in tumor growth in vitro.
24477620 2014 PRMT5 is required for human embryonic stem cell proliferation but not pluripotency.
24453002 2014 Genetic validation of the protein arginine methyltransferase PRMT5 as a candidate therapeutic target in glioblastoma.
24326178 2013 Cellular localization of protein arginine methyltransferase-5 correlates with grade of lung tumors.
24189068 2013 Protein arginine methyltransferase 5 (PRMT5) inhibition induces lymphoma cell death through reactivation of the retinoblastoma tumor suppressor pathway and polycomb repressor complex 2 (PRC2) silencing.
24121109 2013 Activation of PRMT1 and PRMT5 mediates hypoxia- and ischemia-induced apoptosis in human lung epithelial cells and the lung of miniature pigs: the role of p38 and JNK mitogen-activated protein kinases.
24098663 2013 PRMT5 is upregulated in malignant and metastatic melanoma and regulates expression of MITF and p27(Kip1.).
23912080 2013 Protein arginine methyl transferases-3 and -5 increase cell surface expression of cardiac sodium channel.
23904475 2013 PRMT5 dimethylates R30 of the p65 subunit to activate NF-?B.
23892143 2013 Human respiratory syncytial virus N, P and M protein interactions in HEK-293T cells.
23671120 2013 PRMT5 modulates the metabolic response to fasting signals.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23292799 2013 Overexpression of PRMT5 promotes tumor cell growth and is associated with poor disease prognosis in epithelial ovarian cancer.
23261437 2013 Modulation of Epstein-Barr virus nuclear antigen 2-dependent transcription by protein arginine methyltransferase 5.
23133559 2012 Role of type II protein arginine methyltransferase 5 in the regulation of Circadian Per1 gene.
23071334 2012 Crystal structure of the human PRMT5:MEP50 complex.
23048031 2012 Transcription factor positive regulatory domain 4 (PRDM4) recruits protein arginine methyltransferase 5 (PRMT5) to mediate histone arginine methylation and control neural stem cell proliferation and differentiation.
22952863 2012 Protein arginine methyltransferase 5 functions in opposite ways in the cytoplasm and nucleus of prostate cancer cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22726390 2012 Protein arginine methyltransferase 5 is a potential oncoprotein that upregulates G1 cyclins/cyclin-dependent kinases and the phosphoinositide 3-kinase/AKT signaling cascade.
22708516 2012 Protein arginine methyltransferase 5 is essential for growth of lung cancer cells.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22327218 2012 Arginine methylation controls growth regulation by E2F-1.
22269951 2012 HOXA9 methylation by PRMT5 is essential for endothelial cell expression of leukocyte adhesion molecules.
22266372 2012 Protein arginine methyltransferase 5 is an essential component of the hypoxia-inducible factor 1 signaling pathway.
22231400 2012 Symmetric dimethylation of H3R2 is a newly identified histone mark that supports euchromatin maintenance.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22199349 2012 Protein arginine methyltransferase 5 (PRMT5) signaling suppresses protein kinase C?- and p38?-dependent signaling and keratinocyte differentiation.
22143770 2011 Structural insights into protein arginine symmetric dimethylation by PRMT5.
21975038 2011 Versatility of PRMT5-induced methylation in growth control and development.
21917714 2011 Protein arginine methyltransferase 5 regulates ERK1/2 signal transduction amplitude and cell fate through CRAF.
21700716 2011 Protein arginine methyltransferase 5 accelerates tumor growth by arginine methylation of the tumor suppressor programmed cell death 4.
21592330 2011 Cyclooxygenase 2-dependent and independent activation of Akt through casein kinase 2? contributes to human bladder cancer cell survival.
21316606 2011 JAK2V617F-mediated phosphorylation of PRMT5 downregulates its methyltransferase activity and promotes myeloproliferation.
21269460 2011 Initial characterization of the human central proteome.
21262773 2011 Arginine methylation by PRMT5 at a naturally occurring mutation site is critical for liver metabolic regulation by small heterodimer partner.
21258366 2011 Crosstalk between Arg 1175 methylation and Tyr 1173 phosphorylation negatively modulates EGFR-mediated ERK activation.
21159818 2010 Prmt5 is essential for early mouse development and acts in the cytoplasm to maintain ES cell pluripotency.
21081503 2011 RioK1, a new interactor of protein arginine methyltransferase 5 (PRMT5), competes with pICln for binding and modulates PRMT5 complex composition and substrate specificity.
20951943 2010 Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase.
20810653 2010 srGAP2 arginine methylation regulates cell migration and cell spreading through promoting dimerization.
20495075 2010 Identification of a PRMT5-dependent repressor complex linked to silencing of human fetal globin gene expression.
20421892 2010 PRMT5 regulates Golgi apparatus structure through methylation of the golgin GM130.
20159986 2010 Methylation of ribosomal protein S10 by protein-arginine methyltransferase 5 regulates ribosome biogenesis.
19741270 2009 The Kruppel-like zinc finger protein ZNF224 recruits the arginine methyltransferase PRMT5 on the transcriptional repressor complex of the aldolase A gene.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19234465 2009 PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing.
19086919 2009 Fibroblast growth factor 2 (FGF-2) is a novel substrate for arginine methylation by PRMT5.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
19032343 2009 Ski co-repressor complexes maintain the basal repressed state of the TGF-beta target gene, SMAD7, via HDAC3 and PRMT5.
19011621 2008 Arginine methylation regulates the p53 response.
18992153 2008 Expression of BLIMP1/PRMT5 and concurrent histone H2A/H4 arginine 3 dimethylation in fetal germ cells, CIS/IGCNU and germ cell tumors.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
18694959 2008 Protein arginine methyltransferase 5 suppresses the transcription of the RB family of tumor suppressors in leukemia and lymphoma cells.
18495660 2008 Promiscuous modification of the nuclear poly(A)-binding protein by multiple protein-arginine methyltransferases does not affect the aggregation behavior.
18404153 2008 The histone-binding protein COPR5 is required for nuclear functions of the protein arginine methyltransferase PRMT5.
18347060 2008 The LIM protein AJUBA recruits protein arginine methyltransferase 5 to mediate SNAIL-dependent transcriptional repression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17709427 2007 Two distinct arginine methyltransferases are required for biogenesis of Sm-class ribonucleoproteins.
17627275 2007 Low levels of miR-92b/96 induce PRMT5 translation and H3R8/H4R3 methylation in mantle cell lymphoma.
17573539 2007 Mutations in the Type II protein arginine methyltransferase AtPRMT5 result in pleiotropic developmental defects in Arabidopsis.
17437848 2007 The expression and function of androgen receptor coactivator p44 and protein arginine methyltransferase 5 in the developing testis and testicular tumors.
17184735 2007 A putative transcriptional elongation factor hIws1 is essential for mammalian cell proliferation.
16712789 2006 Association of Polycomb group SUZ12 with WD-repeat protein MEP50 that binds to histone H2A selectively in vitro.
16087681 2005 Toward an assembly line for U7 snRNPs: interactions of U7-specific Lsm proteins with PRMT5 and SMN complexes.
15737618 2005 The tumor suppressor DAL-1/4.1B modulates protein arginine N-methyltransferase 5 activity in a substrate-specific manner.
15701830 2005 Identification of gastric cancer-related genes using a cDNA microarray containing novel expressed sequence tags expressed in gastric cancer cells.
15670829 2005 Identification of proteins interacting with the RNAPII FCP1 phosphatase: FCP1 forms a complex with arginine methyltransferase PRMT5 and it is a substrate for PRMT5-mediated methylation.
15654770 2005 Arginine methylation regulates IL-2 gene expression: a role for protein arginine methyltransferase 5 (PRMT5).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485929 2004 Human SWI/SNF-associated PRMT5 methylates histone H3 arginine 8 and negatively regulates expression of ST7 and NM23 tumor suppressor genes.
15369763 2004 Spliceosome Sm proteins D1, D3, and B/B' are asymmetrically dimethylated at arginine residues in the nucleus.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14583623 2004 Human fibrillarin forms a sub-complex with splicing factor 2-associated p32, protein arginine methyltransferases, and tubulins alpha 3 and beta 1 that is independent of its association with preribosomal ribonucleoprotein complexes.
14559996 2003 mSin3A/histone deacetylase 2- and PRMT5-containing Brg1 complex is involved in transcriptional repression of the Myc target gene cad.
12718890 2003 Methylation of SPT5 regulates its interaction with RNA polymerase II and transcriptional elongation properties.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411503 2002 Assisted RNP assembly: SMN and PRMT5 complexes cooperate in the formation of spliceosomal UsnRNPs.
12358155 2002 Screening the proteins that interact with calpain in a human heart cDNA library using a yeast two-hybrid system.
12101096 2002 Negative regulation of transcription by the type II arginine methyltransferase PRMT5.
11756452 2002 A novel WD repeat protein component of the methylosome binds Sm proteins.
11747828 2001 Methylation of Sm proteins by a complex containing PRMT5 and the putative U snRNP assembly factor pICln.
11720283 2001 Symmetrical dimethylation of arginine residues in spliceosomal Sm protein B/B' and the Sm-like protein LSm4, and their interaction with the SMN protein.
11713266 2001 The methylosome, a 20S complex containing JBP1 and pICln, produces dimethylarginine-modified Sm proteins.
11152681 2001 Prmt5, which forms distinct homo-oligomers, is a member of the protein-arginine methyltransferase family.
10734105 2000 Interaction of the somatostatin receptor subtype 1 with the human homolog of the Shk1 kinase-binding protein from yeast.
10531356 1999 The human homologue of the yeast proteins Skb1 and Hsl7p interacts with Jak kinases and contains protein methyltransferase activity.
9843966 1998 Negative regulation of mitosis in fission yeast by the shk1 interacting protein skb1 and its human homolog, Skb1Hs.
9556550 1998 pICln binds to a mammalian homolog of a yeast protein involved in regulation of cell morphology.