Tchem | Protein kinase C iota type |
Calcium- and diacylglycerol-independent serine/ threonine-protein kinase that plays a general protective role against apoptotic stimuli, is involved in NF-kappa-B activation, cell survival, differentiation and polarity, and contributes to the regulation of microtubule dynamics in the early secretory pathway. Is necessary for BCR-ABL oncogene-mediated resistance to apoptotic drug in leukemia cells, protecting leukemia cells against drug-induced apoptosis. In cultured neurons, prevents amyloid beta protein-induced apoptosis by interrupting cell death process at a very early step. In glioblastoma cells, may function downstream of phosphatidylinositol 3-kinase (PI(3)K) and PDPK1 in the promotion of cell survival by phosphorylating and inhibiting the pro-apoptotic factor BAD. Can form a protein complex in non-small cell lung cancer (NSCLC) cells with PARD6A and ECT2 and regulate ECT2 oncogenic activity by phosphorylation, which in turn promotes transformed growth and invasion. In response to nerve growth factor (NGF), acts downstream of SRC to phosphorylate and activate IRAK1, allowing the subsequent activation of NF-kappa-B and neuronal cell survival. Functions in the organization of the apical domain in epithelial cells by phosphorylating EZR. This step is crucial for activation and normal distribution of EZR at the early stages of intestinal epithelial cell differentiation. Forms a protein complex with LLGL1 and PARD6B independently of PARD3 to regulate epithelial cell polarity. Plays a role in microtubule dynamics in the early secretory pathway through interaction with RAB2A and GAPDH and recruitment to vesicular tubular clusters (VTCs). In human coronary artery endothelial cells (HCAEC), is activated by saturated fatty acids and mediates lipid-induced apoptosis.
This gene encodes a member of the protein kinase C (PKC) family of serine/threonine protein kinases. The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. There is a single exon pseudogene mapped on chromosome X. [provided by RefSeq, Jul 2008]
This gene encodes a member of the protein kinase C (PKC) family of serine/threonine protein kinases. The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. There is a single exon pseudogene mapped on chromosome X. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Bipolar Disorder | 666 |
Depressive disorder | 409 |
Mental Depression | 333 |
Disease | Target Count | P-value |
---|---|---|
psoriasis | 6694 | 1.1e-07 |
pancreatic cancer | 2398 | 4.8e-07 |
tuberculosis | 2010 | 8.2e-06 |
glioblastoma | 5792 | 3.2e-05 |
lung adenocarcinoma | 2716 | 1.5e-04 |
ovarian cancer | 8520 | 3.9e-04 |
intraductal papillary-mucinous adenoma (IPMA) | 2955 | 1.3e-03 |
adult high grade glioma | 3801 | 2.2e-03 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 5.5e-03 |
intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 1.4e-02 |
pancreatic ductal adenocarcinoma liver metastasis | 1962 | 2.5e-02 |
Disease | log2 FC | p |
---|---|---|
adult high grade glioma | -1.300 | 2.2e-03 |
glioblastoma | -1.500 | 3.2e-05 |
intraductal papillary-mucinous adenoma (... | 2.000 | 1.3e-03 |
intraductal papillary-mucinous carcinoma... | 1.900 | 5.5e-03 |
intraductal papillary-mucinous neoplasm ... | 1.500 | 1.4e-02 |
lung adenocarcinoma | 1.040 | 1.5e-04 |
ovarian cancer | 2.000 | 3.9e-04 |
pancreatic cancer | 1.200 | 4.8e-07 |
pancreatic ductal adenocarcinoma liver m... | 2.462 | 2.5e-02 |
psoriasis | 1.300 | 1.1e-07 |
tuberculosis | -1.400 | 8.2e-06 |
Species | Source | Disease |
---|---|---|
OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA |
MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKW 1 - 70 IDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANG 71 - 140 HTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQSSMHS 141 - 210 DHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIY 211 - 280 AMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKL 281 - 350 PEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI 351 - 420 APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAA 421 - 490 SVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEP 491 - 560 VQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV 561 - 596 //