Property Summary

Ligand Count 2
NCBI Gene PubMed Count 147
PubMed Score 51.22
PubTator Score 85.57

Knowledge Summary

Patent (5,563)

Expression

  Differential Expression (11)

Protein-protein Interaction (1)

Gene RIF (125)

AA Sequence

MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKW      1 - 70
IDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANG     71 - 140
HTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQSSMHS    141 - 210
DHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIY    211 - 280
AMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKL    281 - 350
PEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI    351 - 420
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAA    421 - 490
SVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEP    491 - 560
VQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV                                      561 - 596
//

Text Mined References (163)

PMID Year Title