Property Summary

NCBI Gene PubMed Count 138
PubMed Score 51.76
PubTator Score 85.57

Knowledge Summary

Patent (5,563)

Expression

Protein-protein Interaction (9)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (116)

PMID Text
26792725 effects. Further studies indicated that PRKCI knockdown-mediated autophagy was associated with the inactivation of phosphatidylinositol 3-kinase alpha/AKT-mammalian target of rapamycin (PIK3CA/AKT-MTOR) signaling.
26475383 the results revealed that PRKCI rs546950 variant decreased the risk of prostate cancer in an Iranian population
25694446 PKCiota binds to Rab14 and that PKCiota requires Rab14 for its correct distribution in cells. As with Rab14, PKCiota protects claudin-2 from lysosomal degradation and, in consequence, modulates epithelial barrier.
25501807 the knockdown of aPKC increases and extends TGFbeta-induced p38 MAPK activation, which sensitizes NSCLC cells to undergo apoptosis.
25118327 Targeting aPKC disables oncogenic signaling by both the EGFR and the proinflammatory cytokine TNFalpha in glioblastoma.
24887021 These data indicates the existence of a SDF-1alpha induced DGKalpha - atypical PKC - beta1 integrin signaling pathway, which is essential for matrix invasion of carcinoma cells.
24876225 Constitutive expression of BAG-1M decreased levels of phosphorylated aPKC.
24786829 The results indicate that induction and activation of PKClambda promote TNBC growth, invasion and metastasis.
24753582 Report up-regulation of MT1-MMP and atypical protein kinase C in hormone receptor-negative breast tumors in association with a higher risk of metastasis. Silencing of aPKC impaired delivery of MT1-MMP from storage compartments and inhibited invasion.
24651432 Suggest that aPKCiota could be an important bio-marker of tumor epithelial-mesenchymal transition, and used as an indicator of invasion and malignancy in hepatocellular carcinoma.
24636699 PKCiota gene amplification is correlated with gender, subtype and distant metastasis in Chinese patients with non-small cell lung cancer.
24603690 PRKCI expression is linked with factors pointing to worse prognosis, higher HER2 levels and a lower survival rate in breast cancer.
24525231 The PRKCI and SOX2 oncogenes are coamplified and cooperate to activate Hedgehog signaling in lung squamous cell carcinoma.
24447338 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
24318287 It regulates progression of lung adenocarcinoma.
24174471 Data demonstrate that PKCiota is required for a tumor-initiating cell phenotype in ovarian cancer.
24162774 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
24045153 The R471C substitution is a change-of-function mutation acting at this substrate-specific recruitment site to selectively disrupt the polarizing activity of PKCiota.
23446420 results demonstrate that aPKC-iota/lambda is critical for hedgehog-dependent processes and implicates aPKC-iota/lambda as a new, tumour-selective therapeutic target for the treatment of smoothened-inhibitor-resistant cancers
23439680 Morg1 facilitates Par6-aPKC binding to Crb3 for definition of apical identity of epithelial cells.
23396968 site-specific Dvl2 phosphorylation is required for Dvl2 association with PKCiota; this interaction is likely to be one of the mechanisms essential for Wnt3a-dependent neurite outgrowth
23359356 PKCiota positively regulated beta-catenin through negatively regulated autophagy and depletion of PKCiota promoted apoptosis via autophagic degradation of beta-catenin in esophageal cancer cells.
23224638 PKCiota knockdown sensitized cells to oxidative stress-induced apoptosis, whereas forced PKCiota expression counteracted the oxidative stress-induced apoptosis via Hsc70.
22522453 In summary, the PI3K/PKCiota regulates the alternative splicing of Bcl-x pre-mRNA with implications in the cell survival of NSCLC cells.
22349825 protein kinase C iota as a therapeutic target in alveolar rhabdomyosarcoma
22120720 It was concluded that protein kinase C iota is overexpressed in a subset of cancers where the enzyme functions to suppress premature senescence. This function appears to be restricted to cancer cells.
22114277 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
22021906 glioma cells may be proliferating through a novel PI (3)-kinase-/PKC-iota/Cdk7/cdk2-mediated pathway.
21775625 atypical protein kinase C phosphorylates Numb to prevent its binding to p120 and alpha-adaptin, thereby attenuating E-cadherin endocytosis to maintain apicobasal polarity
21685893 Report a willin(FRMD6)/Par3-aPKC-ROCK pathway that controls epithelial apical morphology.
21667320 Changes in PKC iota, PKC zeta, and non-muscle MyoIIA expression are likely to participate in pathogenesis of epithelial barrier function in response to local pro-inflammatory signals.
21651489 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
21535317 aPKClambda/iota-IL-6 axis is a reliable prognostic factor for the biochemical recurrence of this cancer.
21497093 The results strongly support the notion that KIBRA regulates epithelial cell polarity by suppressing apical exocytosis through direct inhibition of aPKC kinase activity in the PAR3-aPKC-PAR6 complex.
21419810 Data suggest that glioma cell survival occurs through a PI(3)-kinase/PDK1/PKC-iota/BAD mediated pathway.
21373201 An association with prostate cancer risk for two SNPs belonging to PRKCI, a gene which is frequently overexpressed in various neoplasms, including prostate cancer.
21310827 PKCiota promotes tumorigenicity and metastasis of human esophageal cancer and that SKP2 is a candidate downstream effector of PKCiota signaling in ESCC.
21300793 Data conclude that Par6B and aPKC control mitotic spindle orientation in polarized epithelia and, furthermore, that aPKC coordinately regulates multiple processes to promote morphogenesis.
21189248 a model in which PKCiota-mediated phosphorylation regulates Ect2 binding to the oncogenic PKCiota-Par6 complex thereby activating Rac1 activity and driving transformed growth and invasion.
20945390 PKCiota is required for the transformed phenotype of lung, pancreatic, ovarian, prostate, colon, and brain cancer cells.
20815904 PKCiota has a role in both glioblastoma invasion and proliferation, two key aspects in the malignant nature of this disease
20686607 The results suggest that PRKCI is an indirect co-regulator of HSF1 activity and the heat shock response.
20463008 These data identify atypical PKC isozymes as STAT and ERK activators that mediate c-fos and collagenase expression.
20445233 Crystal structures of the PKC-iota kinase domain in its ATP-bound and apo forms were determined at 2.1 and 2.0 A resolution, respectively.
20336759 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
19805306 Findings not only explain the link between aPKClambda/iota and IL-6, implicated in the progression a variety of cancers, but also establish a molecular change involved in the development of HRPC.
19774416 High expression of protein kinase C lambda is associated with gastric cancer recurrence.
19617897 Ect2 and PKCiota are genetically and functionally linked in NSCLC, acting to coordinately drive tumor cell proliferation and invasion through formation of an oncogenic PKCiota-Par6alpha-Ect2 complex.
19549684 Filamentous keratins and Hsp70 are required for the rescue rephosphorylation of mature atypical PKC, regulating the subcellular distribution and steady-state levels of active PKC iota.
19363595 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
19327373 Protein kinase C iota mediates lipid-induced apoptosis of human coronary artery endothelial cells.
19290490 expression of aPKC-iota was closely related to pathological differentiation, tumor size, invasion, and metastasis of HCC.
19243387 PKC-iota is required for cell survival in both transformed non-malignant prostate RWPE-1 cells and androgen-independent malignant prostate DU-145 cells. Suppressing PKC-iota lead to apoptosis in DU-145 prostate cells.
19101699 Differentiation degree and invasion of hepatoma are related to the expression of PKC-iota, which plays an important role in invasion and metastasis of hepatoma.
19060919 ezrin is regulated during osteosarcoma metastasis by PKC
18632643 Atypical protein kinase C iota expression has a role in aurothiomalate sensitivity in lung cancer cells
18577246 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
18571841 Atypical protein kinase C (PKC-iota/-zeta) phosphorylates IKKalphabeta in transformed non-malignant and malignant prostate cell survival.
18562307 Neph1-Nephrin proteins bind the Par3-Par6-atypical protein kinase C (aPKC) complex to regulate podocyte cell polarity
18538170 This is the first evidence to show aPKC lambda/iota overexpression in breast cancer and its localization associated with the trend of pathologic type of the tumor.
18427549 data define a PKCiota-Par6alpha-Rac1 signaling axis that drives anchorage-independent growth and invasion of NSCLC cells through induction of MMP-10 expression
18270268 Apically localized phosphorylation by PKCiota is essential for the activation and normal distribution of ezrin at the early stages of intestinal epithelial cell differentiation.
18234642 The expressions of aPKC-iota and E-cadherin may reflect the differentiation and invasive potential of cholangiocarcinoma
18212741 in glioblastoma, PKC iota and RhoB are mutually antagonistic, potentially creating a sensitive switch between invasive and non-invasive phenotypes
18211289 presence of PKC-iota may be required for cell proliferation to take place
17990328 a molecular marker for metastasis and occult advanced tumor stages in esophageal squamous cell carcinomas
17626746 The expression of aPKC-iota and E-cadherin may reflect the differentiation and invasive potential of cholangiocarcinoma. As a polar regulation-associated protein, aPKC-iota may play a role in the invasion and metastasis of cholangiocarcinoma.
17588663 These data demonstrate that atypical PKCzeta/iota isotypes serve as direct downstream targets of PKCtheta in the signalling pathway leading to NF-kappaB activation in T lymphocytes.
17570678 evidence that PKC iota is a human oncogene is discussed; review of mechanisms controlling PKC iota expression in human cancers; description of the molecular details of PKC iota-mediated oncogenic signaling [review]
17133348 These data indicate that the G-CSF-induced dynamic translocation and activation processes of PKCiota are important to neutrophilic proliferation.
16820593 High levels of endothelin-1 impair endothelial nitric oxide production via PKCLambda-mediated inhibition of eNOS expression.
16644736 atypical PKCs are required for insulin-stimulated glucose transport in myocytes and adipocytes
16361262 a novel role for PKCiota as a nicotine-activated, physiological calpain kinase that directly phosphorylates and activates calpains.
16125198 Results describe the crystal structure of the catalytic domain of atypical protein kinase C iota in complex with bis(indolyl)maleimide at 3.0A resolution.
16116079 PKCiota as a potential oncogene in ovarian cancer regulating epithelial cell polarity and proliferation
15994303 Data demonstrate that protein kinase Ciota is a critical lung cancer gene that activates a Rac1-->Pak-->Mek1,2-->Erk1,2 signaling pathway required for transformed growth.
15887250 PKCI mediates opposing effects on Na(+)-K(+)-Exchanging ATPase activity in a breast neoplasm cell line.
15705582 an NNK-activated physiological Bad kinase, can phosphorylate and inactivate BH3, enhancing survival of lung cancer cells
15695176 Confocal microscopy revealed the co-localization of PKC-iota with CAK/cdk7 in both the cytoplasm and nucleus of U-373 MG glioma cells, supporting its role in cell signaling.
15689238 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
15590654 crystal structure of the complex of PKCiota and Par6alpha PB1 domains to a resolution of 1.5 A
15192100 protein kinase C alpha, iota, and theta binding to L-selectin cytoplasmic domain is modulated by receptor phosphorylation
15143057 determined the three-dimensional structure of the PB1 domain of PKCiota by NMR and found that the PB1 domain adopts a ubiquitin fold
15024028 Data demonstrate that protein kinase C (PKC) iota is required for oncogenic Ras- and carcinogen-mediated colon carcinogenesis in vivo and define a procarcinogenic signaling axis consisting of Ras, PKCiota, and Rac1.
14670960 Bcr-Abl-mediated transformation involves transcriptional activation of the PKCiota gene, which in turn is required for Bcr-Abl-mediated chemoresistance.
14570876 protein kinase C iota/lambda binds to Rab 2, which inhibits aPKCiota/lambda-dependent GADPH phosphorylation
12815264 Complete assignments for residues 2-14 and 21-118 except for 8 prolines have been obtained and deposited as BMRB-5661.
12791393 PKCiota has a role in regulating cell survival in tumor cells
12482669 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
12140376 PKC iota was the only isoform exclusively detected in tumour lysates, spontaneously transformed melanoma cells & cell lines, but not in normal melanocytes. It may therefore be associated with the transformed phenotype in human melanoma.
11978974 The assignment of PRKCI to bovine chromosome 1q34-->q36 by FISH suggests a new assignment to human chromosome 3.
11919157 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
11833470 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
11504923 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
11154208 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
11141237 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
11044099 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
10843712 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
10641798 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
10491200 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
9671211 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
9446795 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
9151826 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
8914829 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
8627654 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
8599832 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
8473314 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
8206685 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
7876252 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
7850771 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
7642615 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
3259291 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
2182321 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
2139676 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
1970444 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells
1832084 HIV-1 gp120 upregulates the expression of protein kinase C, iota (PRKCI) in human B cells

AA Sequence

MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKW      1 - 70
IDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANG     71 - 140
HTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQSSMHS    141 - 210
DHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIY    211 - 280
AMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKL    281 - 350
PEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI    351 - 420
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAA    421 - 490
SVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEP    491 - 560
VQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV                                      561 - 596
//

Text Mined References (154)

PMID Year Title
26977885 2016 Protein Kinase C? Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma.
26792725 2016 PRKCI negatively regulates autophagy via PIK3CA/AKT-MTOR signaling.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26475383 2015 Association of polymorphisms in PRKCI gene and risk of prostate cancer in a sample of Iranian Population.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25694446 2015 PKC? interacts with Rab14 and modulates epithelial barrier function through regulation of claudin-2 levels.
25501807 2015 aPKC alters the TGF? response in NSCLC cells through both Smad-dependent and Smad-independent pathways.
25118327 2014 Targeting aPKC disables oncogenic signaling by both the EGFR and the proinflammatory cytokine TNF? in glioblastoma.
24887021 2014 The diacylglycerol kinase ?/atypical PKC/?1 integrin pathway in SDF-1? mammary carcinoma invasiveness.
24876225 2014 The BAG-1 isoform BAG-1M regulates keratin-associated Hsp70 chaperoning of aPKC in intestinal cells during activation of inflammatory signaling.
24786829 2014 PKC?/? signaling promotes triple-negative breast cancer growth and metastasis.
24753582 2014 Control of MT1-MMP transport by atypical PKC during breast-cancer progression.
24682284 2014 Evolutionary and molecular facts link the WWC protein family to Hippo signaling.
24651432 2014 The aPKC? blocking agent ATM negatively regulates EMT and invasion of hepatocellular carcinoma.
24636699 2014 The oncogenic role of PKCiota gene amplification and overexpression in Chinese non-small cell lung cancer.
24603690 2014 Association of PKC? expression with clinicopathological characteristics of breast cancer.
24525231 2014 The PRKCI and SOX2 oncogenes are coamplified and cooperate to activate Hedgehog signaling in lung squamous cell carcinoma.
24375676 2014 mTORC2 phosphorylates protein kinase C? to regulate its stability and activity.
24318287 2013 Localization of aPKC lambda/iota and its interacting protein, Lgl2, is significantly associated with lung adenocarcinoma progression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24174471 2013 PKC? maintains a tumor-initiating cell phenotype that is required for ovarian tumorigenesis.
24045153 2013 A cancer-associated mutation in atypical protein kinase C? occurs in a substrate-specific recruitment motif.
23446420 2013 GLI activation by atypical protein kinase C ?/? regulates the growth of basal cell carcinomas.
23439680 2013 The WD40 protein Morg1 facilitates Par6-aPKC binding to Crb3 for apical identity in epithelial cells.
23396968 2013 Atypical protein kinase C? is required for Wnt3a-dependent neurite outgrowth and binds to phosphorylated dishevelled 2.
23359356 2014 Inhibition of atypical protein kinase C? induces apoptosis through autophagic degradation of ?-catenin in esophageal cancer cells.
23224638 2013 PKC? counteracts oxidative stress by regulating Hsc70 in an esophageal cancer cell line.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22522453 2012 The Proto-oncogene PKC? regulates the alternative splicing of Bcl-x pre-mRNA.
22349825 2013 Protein kinase C iota as a therapeutic target in alveolar rhabdomyosarcoma.
22120720 2012 Repression of cancer cell senescence by PKC?.
22021906 2012 Regulation of Cdk7 activity through a phosphatidylinositol (3)-kinase/PKC-?-mediated signaling cascade in glioblastoma.
21983565 2011 Microtubules induce self-organization of polarized PAR domains in Caenorhabditis elegans zygotes.
21775625 2011 Numb controls E-cadherin endocytosis through p120 catenin with aPKC.
21685893 2011 Willin and Par3 cooperatively regulate epithelial apical constriction through aPKC-mediated ROCK phosphorylation.
21667320 2011 Aberrant expression of the polarity complex atypical PKC and non-muscle myosin IIA in active and inactive inflammatory bowel disease.
21535317 2011 Coexpression of aPKC?/? and IL-6 in prostate cancer tissue correlates with biochemical recurrence.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21497093 2011 KIBRA suppresses apical exocytosis through inhibition of aPKC kinase activity in epithelial cells.
21419810 2011 PKC-? promotes glioblastoma cell survival by phosphorylating and inhibiting BAD through a phosphatidylinositol 3-kinase pathway.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21373201 2011 Genetic variability of the mTOR pathway and prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
21310827 2011 Atypical protein kinase C? (PKC?) promotes metastasis of esophageal squamous cell carcinoma by enhancing resistance to Anoikis via PKC?-SKP2-AKT pathway.
21300793 2011 Par6B and atypical PKC regulate mitotic spindle orientation during epithelial morphogenesis.
21269460 2011 Initial characterization of the human central proteome.
21189248 2011 Oncogenic activity of Ect2 is regulated through protein kinase C iota-mediated phosphorylation.
20945390 2011 Protein kinase C? expression and oncogenic signaling mechanisms in cancer.
20815904 2010 Coordination of glioblastoma cell motility by PKC?.
20808283 2010 NBR1 is a new PB1 signalling adapter in Th2 differentiation and allergic airway inflammation in vivo.
20686607 2010 The identification of protein kinase C iota as a regulator of the Mammalian heat shock response using functional genomic screens.
20562859 2010 Network organization of the human autophagy system.
20463008 2010 Protein kinase C isoforms zeta and iota mediate collagenase expression and cartilage destruction via STAT3- and ERK-dependent c-fos induction.
20445233 2010 Structures of the PKC-iota kinase domain in its ATP-bound and apo forms reveal defined structures of residues 533-551 in the C-terminal tail and their roles in ATP binding.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19805306 2009 aPKClambda/iota promotes growth of prostate cancer cells in an autocrine manner through transcriptional activation of interleukin-6.
19774416 2010 High expression of atypical protein kinase C lambda/iota in gastric cancer as a prognostic factor for recurrence.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19617897 2009 Ect2 links the PKCiota-Par6alpha complex to Rac1 activation and cellular transformation.
19549684 2009 Rescue of atypical protein kinase C in epithelia by the cytoskeleton and Hsp70 family chaperones.
19327373 2009 Protein kinase C iota mediates lipid-induced apoptosis of human coronary artery endothelial cells.
19290490 2009 Expression of P-aPKC-iota, E-cadherin, and beta-catenin related to invasion and metastasis in hepatocellular carcinoma.
19243387 2009 Role of protein kinase C-iota in transformed non-malignant RWPE-1 cells and androgen-independent prostate carcinoma DU-145 cells.
19101699 2009 Significance and expression of atypical protein kinase C-iota in human hepatocellular carcinoma.
19060919 2009 The actin-cytoskeleton linker protein ezrin is regulated during osteosarcoma metastasis by PKC.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18632643 2008 Atypical protein kinase C iota expression and aurothiomalate sensitivity in human lung cancer cells.
18571841 2008 Atypical protein kinase C phosphorylates IKKalphabeta in transformed non-malignant and malignant prostate cell survival.
18562307 2008 Neph-Nephrin proteins bind the Par3-Par6-atypical protein kinase C (aPKC) complex to regulate podocyte cell polarity.
18538170 2008 The overexpression and altered localization of the atypical protein kinase C lambda/iota in breast cancer correlates with the pathologic type of these tumors.
18427549 2008 Matrix metalloproteinase-10 is a critical effector of protein kinase Ciota-Par6alpha-mediated lung cancer.
18270268 2008 Atypical protein kinase C (iota) activates ezrin in the apical domain of intestinal epithelial cells.
18234642 2008 Correlation of aPKC-iota and E-cadherin expression with invasion and prognosis of cholangiocarcinoma.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18212741 2008 Regulation of glioblastoma cell invasion by PKC iota and RhoB.
18211289 2008 Involvement of PKC-iota in glioma proliferation.
17990328 2008 Amplification of PRKCI, located in 3q26, is associated with lymph node metastasis in esophageal squamous cell carcinoma.
17979178 2007 A novel tandem affinity purification strategy for the efficient isolation and characterisation of native protein complexes.
17626746 2007 [Expression and significance of aPKC-iota and E-cadherin in cholangiocarcinoma].
17588663 2008 PKCtheta cooperates with atypical PKCzeta and PKCiota in NF-kappaB transactivation of T lymphocytes.
17570678 2007 Protein kinase C iota: human oncogene, prognostic marker and therapeutic target.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17313651 2007 WD-repeat-propeller-FYVE protein, ProF, binds VAMP2 and protein kinase Czeta.
17133348 2007 Granulocyte colony-stimulating factor promotes the translocation of protein kinase Ciota in neutrophilic differentiation cells.
17057644 2006 A distinct PAR complex associates physically with VE-cadherin in vertebrate endothelial cells.
16997282 2006 NF-kappaB functions in the nervous system: from development to disease.
16820593 2006 Elevated endothelin-1 levels impair nitric oxide homeostasis through a PKC-dependent pathway.
16792529 2006 A WD-FYVE protein binds to the kinases Akt and PKCzeta/lambda.
16644736 2006 Repletion of atypical protein kinase C following RNA interference-mediated depletion restores insulin-stimulated glucose transport.
16452474 2006 Src-dependent aprotein kinase C iota/lambda (aPKCiota/lambda) tyrosine phosphorylation is required for aPKCiota/lambda association with Rab2 and glyceraldehyde-3-phosphate dehydrogenase on pre-golgi intermediates.
16361262 2006 Protein kinase Ciota promotes nicotine-induced migration and invasion of cancer cells via phosphorylation of micro- and m-calpains.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16125198 2005 Crystal structure of the catalytic domain of human atypical protein kinase C-iota reveals interaction mode of phosphorylation site in turn motif.
16116079 2005 Atypical PKCiota contributes to poor prognosis through loss of apical-basal polarity and cyclin E overexpression in ovarian cancer.
15994303 2005 Atypical protein kinase Ciota plays a critical role in human lung cancer cell growth and tumorigenicity.
15887250 2005 Atypical PKC-zeta and PKC-iota mediate opposing effects on MCF-7 Na+/K+ATPase activity.
15705582 2005 Survival function of protein kinase C{iota} as a novel nitrosamine 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone-activated bad kinase.
15695176 2005 Cyclin-dependent kinase activating kinase/Cdk7 co-localizes with PKC-iota in human glioma cells.
15590654 2005 Structure of a cell polarity regulator, a complex between atypical PKC and Par6 PB1 domains.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302858 2004 DaPKC-dependent phosphorylation of Crumbs is required for epithelial cell polarity in Drosophila.
15192100 2004 The interaction of protein kinase C isozymes alpha, iota, and theta with the cytoplasmic domain of L-selectin is modulated by phosphorylation of the receptor.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15143057 2004 Solution structure of atypical protein kinase C PB1 domain and its mode of interaction with ZIP/p62 and MEK5.
15037605 2004 Protein kinase C (PKC) betaII induces cell invasion through a Ras/Mek-, PKC iota/Rac 1-dependent signaling pathway.
15024028 2004 Protein kinase Ciota is required for Ras transformation and colon carcinogenesis in vivo.
14684752 2004 Regulation of interleukin receptor-associated kinase (IRAK) phosphorylation and signaling by iota protein kinase C.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
14670960 2004 Bcr-Abl regulates protein kinase Ciota (PKCiota) transcription via an Elk1 site in the PKCiota promoter.
14570876 2003 Rab2 interacts directly with atypical protein kinase C (aPKC) iota/lambda and inhibits aPKCiota/lambda-dependent glyceraldehyde-3-phosphate dehydrogenase phosphorylation.
12893243 2003 Centaurin-alpha(1) associates with and is phosphorylated by isoforms of protein kinase C.
12871960 2003 Atypical protein kinase C plays a critical role in protein transport from pre-Golgi intermediates.
12815264 2003 Rapid backbone 1H, 13C, and 15N assignment of the V1 domain of human PKC iota using the new program IBIS.
12791393 2003 Regulation of cell survival by atypical protein kinase C isozymes.
12761193 2003 Protein kinase C lambda/iota (PKClambda/iota): a PKC isotype essential for the development of multicellular organisms.
12725730 2003 Mammalian Lgl forms a protein complex with PAR-6 and aPKC independently of PAR-3 to regulate epithelial cell polarity.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12140376 2002 Protein kinase C isoforms in normal and transformed cells of the melanocytic lineage.
11978974 2001 The assignment of PRKCI to bovine chromosome 1q34-->q36 by FISH suggests a new assignment to human chromosome 3.
11919157 2002 HIV-1 Tat protein induces interleukin-10 in human peripheral blood monocytes: involvement of protein kinase C-betaII and -delta.
11891849 2002 Phosphorylation of tyrosine 256 facilitates nuclear import of atypical protein kinase C.
11856176 2002 Human glioma PKC-iota and PKC-betaII phosphorylate cyclin-dependent kinase activating kinase during the cell cycle.
11833470 2001 [HIV-1 Tat protein induces IL-10 production by human monocytes: implications of the PKC and calcium pathway].
11724794 2002 Glyceraldehyde-3-phosphate dehydrogenase is phosphorylated by protein kinase Ciota /lambda and plays a role in microtubule dynamics in the early secretory pathway.
11713277 2001 Nerve growth factor stimulates multisite tyrosine phosphorylation and activation of the atypical protein kinase C's via a src kinase pathway.
11669302 2001 Protein kinase C isoforms in human erythrocytes.
11260256 2001 Human homologues of the Caenorhabditis elegans cell polarity protein PAR6 as an adaptor that links the small GTPases Rac and Cdc42 to atypical protein kinase C.
11257119 2001 Atypical protein kinase C is involved in the evolutionarily conserved par protein complex and plays a critical role in establishing epithelia-specific junctional structures.
11244088 2001 The atypical protein kinase C-interacting protein p62 is a scaffold for NF-kappaB activation by nerve growth factor.
11158308 2001 MEK5, a new target of the atypical protein kinase C isoforms in mitogenic signaling.
11154208 2001 HIV-1 Tat promotes monocyte chemoattractant protein-1 secretion followed by transmigration of monocytes.
11044099 2000 Tat protein of human immunodeficiency virus type 1 induces interleukin-10 in human peripheral blood monocytes: implication of protein kinase C-dependent pathway.
11042363 2000 Protein kinase C iota protects neural cells against apoptosis induced by amyloid beta-peptide.
10906326 2000 Unique structural and functional properties of the ATP-binding domain of atypical protein kinase C-iota.
10843712 2000 Release of calcium from inositol 1,4,5-trisphosphate receptor-regulated stores by HIV-1 Tat regulates TNF-alpha production in human macrophages.
10764742 2000 A 3-phosphoinositide-dependent protein kinase-1 (PDK1) docking site is required for the phosphorylation of protein kinase Czeta (PKCzeta ) and PKC-related kinase 2 by PDK1.
10567402 1999 Suppression of microphthalmia transcriptional activity by its association with protein kinase C-interacting protein 1 in mast cells.
10467349 1999 Overexpression of atypical PKC in PC12 cells enhances NGF-responsiveness and survival through an NF-kappaB dependent pathway.
10356400 1999 The interaction of p62 with RIP links the atypical PKCs to NF-kappaB activation.
10022904 1999 Activation of IkappaB kinase beta by protein kinase C isoforms.
9933579 1999 Protein kinase Ciota activity is necessary for Bcr-Abl-mediated resistance to drug-induced apoptosis.
9671211 1998 Human immunodeficiency virus Tat protein induces interleukin 6 mRNA expression in human brain endothelial cells via protein kinase C- and cAMP-dependent protein kinase pathways.
9566925 1998 Localization of atypical protein kinase C isoforms into lysosome-targeted endosomes through interaction with p62.
9446795 1998 Extracellular HIV-1 Tat protein induces a rapid and selective activation of protein kinase C (PKC)-alpha, and -epsilon and -zeta isoforms in PC12 cells.
9346882 1997 Atypical protein kinase C iota protects human leukemia cells against drug-induced apoptosis.
8914829 1996 In vitro phosphorylation of human immunodeficiency virus type 1 Tat protein by protein kinase C: evidence for the phosphorylation of amino acid residue serine-46.
8627654 1996 Extracellular human immunodeficiency virus type 1 Tat protein is associated with an increase in both NF-kappa B binding and protein kinase C activity in primary human astrocytes.
8524286 1996 Lambda-interacting protein, a novel protein that specifically interacts with the zinc finger domain of the atypical protein kinase C isotype lambda/iota and stimulates its kinase activity in vitro and in vivo.
8226978 1993 Molecular cloning and characterization of PKC iota, an atypical isoform of protein kinase C derived from insulin-secreting cells.
7607695 1995 Human protein kinase C Iota gene (PRKCI) is closely linked to the BTK gene in Xq21.3.
2182321 1990 Trans-activation of HIV-1 LTR-directed gene expression by tat requires protein kinase C.