Property Summary

Ligand Count 113
NCBI Gene PubMed Count 277
PubMed Score 21.72
PubTator Score 387.91

Knowledge Summary

Patent (5,673)


  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.800 2.2e-06
astrocytic glioma -2.500 1.2e-03
Astrocytoma, Pilocytic -2.500 1.6e-08
atypical teratoid / rhabdoid tumor -3.200 4.7e-13
ependymoma -3.000 1.7e-03
glioblastoma -2.200 8.3e-10
group 3 medulloblastoma -1.100 4.7e-03
lung adenocarcinoma -1.400 9.1e-18
medulloblastoma, large-cell -3.500 1.8e-07
non-small cell lung cancer -2.149 9.6e-28
oligodendroglioma -2.200 3.8e-03
osteosarcoma 1.494 9.6e-07
primitive neuroectodermal tumor -2.400 1.2e-03

Protein-protein Interaction (10)

Gene RIF (226)

AA Sequence

DFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP                                     701 - 737

Text Mined References (292)

PMID Year Title