Property Summary

NCBI Gene PubMed Count 92
PubMed Score 95.98
PubTator Score 74.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Disease Target Count Z-score Confidence
Familial atrial fibrillation 23 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 5.122 2.6
Glycogen storage disease 39 4.887 2.4
Disease Target Count Z-score Confidence
Danon disease 8 3.262 1.6
Fabry disease 10 3.057 1.5

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.400 3.1e-04
atypical teratoid / rhabdoid tumor -1.600 3.3e-05
Endometriosis -1.076 1.9e-02
glioblastoma -1.200 1.4e-03
group 4 medulloblastoma -1.200 3.5e-03
malignant mesothelioma -2.600 9.2e-08
medulloblastoma, large-cell -2.600 8.1e-06
osteosarcoma -1.564 5.7e-05
ovarian cancer 1.200 3.2e-02
pancreatic ductal adenocarcinoma liver m... -1.029 2.9e-03
primitive neuroectodermal tumor -1.300 2.7e-03
psoriasis -1.100 4.7e-04

Protein-protein Interaction (6)

Gene RIF (65)

AA Sequence

MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSSRKVDSPFGPG      1 - 70
SPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRRMSFSGIFRSSSKESSPNSNP     71 - 140
ATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQ    141 - 210
SPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKL    211 - 280
VVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWR    281 - 350
ELYLQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAF    351 - 420
MKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNL    421 - 490
DITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALILTPAG    491 - 560
AKQKETETE                                                                 561 - 569
//

Text Mined References (100)

PMID Year Title