Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.05
PubTator Score 51.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.285 1.9e-02
malignant mesothelioma 2.500 1.0e-08
glioblastoma 1.200 6.3e-06
group 3 medulloblastoma 2.800 5.9e-07
medulloblastoma, large-cell 1.700 3.1e-05
primitive neuroectodermal tumor 1.700 2.7e-04
adrenocortical carcinoma 1.386 2.4e-04
non-small cell lung cancer 1.343 2.9e-14
lung cancer 2.300 6.7e-04
colon cancer 1.400 2.8e-02
pediatric high grade glioma 1.100 1.0e-03
primary Sjogren syndrome 1.100 3.2e-04

 GWAS Trait (1)

Protein-protein Interaction (13)

Gene RIF (4)

PMID Text
26710848 Data suggest that PRIM1-p58,C-terminal domain stays bound to initiating NTP and 3prime-overhang DNA during whole cycle of RNA primer synthesis; meanwhile, PRIM1-p49 slides along DNA template toward 5prime-end with PRIM1-p58,N-terminal domain attached.
25550159 Data indicate that the conformational changes in primase are necessary to accomplish the initiation and then elongation of RNA synthesis.
22593576 Findings indicate that tethering of DNA primase Prim1 to the replisome by DNA polymerase alpha (pol alpha) is critical for the normal action of DNA replication forks in eukaryotic cells.
20030400 Mechanisms by which human DNA primase chooses to polymerize a nucleoside triphosphate

AA Sequence

METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEM      1 - 70
QKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIR     71 - 140
IIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHP    141 - 210
FIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQ    211 - 280
NNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTI    281 - 350
SFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF    351 - 420
//

Text Mined References (22)

PMID Year Title
26710848 2016 Insight into the Human DNA Primase Interaction with Template-Primer.
25550159 2015 Crystal structure of the human primase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22593576 2012 A conserved motif in the C-terminal tail of DNA polymerase ? tethers primase to the eukaryotic replisome.
22267201 2012 Meta-analyses identify 13 loci associated with age at menopause and highlight DNA repair and immune pathways.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20030400 2010 Mechanisms by which human DNA primase chooses to polymerize a nucleoside triphosphate.
19946888 2010 Defining the membrane proteome of NK cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11917009 2002 Physical and functional interactions of the tumor suppressor protein p53 and DNA polymerase alpha-primase.
11473323 2001 RPA governs endonuclease switching during processing of Okazaki fragments in eukaryotes.
10504261 1999 Interactions of DNA with human DNA primase monitored with photoactivatable cross-linking agents: implications for the role of the p58 subunit.
10441007 1999 Amplifications of DNA primase 1 (PRIM1) in human osteosarcoma.
9822671 1998 Replication factor C disengages from proliferating cell nuclear antigen (PCNA) upon sliding clamp formation, and PCNA itself tethers DNA polymerase delta to DNA.
9705292 1998 Primase activity of human DNA polymerase alpha-primase. Divalent cations stabilize the enzyme activity of the p48 subunit.
9268648 1997 Mapping of the human DNA primase 1 (PRIM1) to chromosome 12q13.
8530050 1995 Assignment of the 49-kDa (PRIM1) and 58-kDa (PRIM2A and PRIM2B) subunit genes of the human DNA primase to chromosome bands 1q44 and 6p11.1-p12.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8026492 1994 DNA replication in vitro by recombinant DNA-polymerase-alpha-primase.
6693436 1984 DNA primase from KB cells. Characterization of a primase activity tightly associated with immunoaffinity-purified DNA polymerase-alpha.