Property Summary

NCBI Gene PubMed Count 21
PubMed Score 34.24
PubTator Score 22.36

Knowledge Summary

Patent

No data available

Expression

 CSPA Cell Line (1)

Gene RIF (7)

PMID Text
23826326 The unique expression of a 38 kDa PRELP in chronic lymphocytic leukemia (CLL) cells may suggest involvement in the pathobiology of CLL
23442027 PRELP expression governs stem cells to differentiate into ligament tissue in a mouse model.
22267731 PRELP may down-regulate complement attack at basement membranes and on damaged cartilage and therefore limit pathological complement activation in inflammatory disease such as RA.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
17123807 PRELP overexpression leads to a connective tissue phenotype in the skin, where the organization of collagen fibrils in the dermis was perturbed and the thickness of the hypodermal fat layer was diminished.
17093390 Relative abundance of PRELP mRNA and protein inhuman sclera, and observed age-related variation in scleral PRELP expression suggests that PRELP may play critical role in regulating biomechanical properties of scleral extracellular matrix.

AA Sequence

MRSPLCWLLPLLILASVAQGQPTRRPRPGTGPGRRPRPRPRPTPSFPQPDEPAEPTDLPPPLPPGPPSIF      1 - 70
PDCPRECYCPPDFPSALYCDSRNLRKVPVIPPRIHYLYLQNNFITELPVESFQNATGLRWINLDNNRIRK     71 - 140
IDQRVLEKLPGLVFLYMEKNQLEEVPSALPRNLEQLRLSQNHISRIPPGVFSKLENLLLLDLQHNRLSDG    141 - 210
VFKPDTFHGLKNLMQLNLAHNILRKMPPRVPTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTD    211 - 280
RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVP    281 - 350
HLRYLRLDGNYLKPPIPLDLMMCFRLLQSVVI                                          351 - 382
//

Text Mined References (23)

PMID Year Title
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
23826326 2013 A proline/arginine-rich end leucine-rich repeat protein (PRELP) variant is uniquely expressed in chronic lymphocytic leukemia cells.
23442027 2013 Proline/arginine-rich end leucine-rich repeat protein converts stem cells to ligament tissue and Zn(II) influences its nuclear expression.
22267731 2012 PRELP protein inhibits the formation of the complement membrane attack complex.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17123807 2007 The consequence of PRELP overexpression on skin.
17093390 2006 Small leucine rich repeat proteoglycans (SLRPs) in the human sclera: identification of abundant levels of PRELP.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437997 2003 PRELP, collagen, and a theory of Hutchinson-Gilford progeria.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11847210 2002 The leucine-rich repeat protein PRELP binds perlecan and collagens and may function as a basement membrane anchor.
9806887 1998 Characterization of the human proline/arginine-rich end leucine-rich repeat protein (PRELP) gene promoter and identification of a repressor element.
8954791 1996 The gene organization, chromosome location, and expression of a 55-kDa matrix protein (PRELP) of human articular cartilage.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7592739 1995 The primary structure of a basic leucine-rich repeat protein, PRELP, found in connective tissues.