Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.17
PubTator Score 0.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.080 5.8e-07
adult high grade glioma 1.400 1.1e-03
Astrocytoma, Pilocytic 1.600 6.5e-06
atypical teratoid / rhabdoid tumor 1.100 3.1e-03
Breast cancer 3.500 2.3e-02
ependymoma 1.300 3.0e-06
glioblastoma 1.600 2.1e-08
group 4 medulloblastoma 1.500 2.8e-04
intraductal papillary-mucinous carcinoma... 1.200 2.4e-02
intraductal papillary-mucinous neoplasm ... 1.600 2.6e-02
lung adenocarcinoma 1.333 1.5e-04
lung cancer 1.300 9.6e-03
medulloblastoma, large-cell 2.000 1.2e-03
Multiple myeloma 1.150 8.5e-05
ovarian cancer 1.500 6.0e-03
primary Sjogren syndrome 1.200 2.7e-03
primitive neuroectodermal tumor 1.500 5.1e-04

Gene RIF (1)

AA Sequence

MKIWTSEHVFDHPWETVTTAAMQKYPNPMNPSVVGVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIG      1 - 70
AARTKTYVQEHSVVDPVEKTMELKSTNISFTNMVSVDERLIYKPHPQDPEKTVLTQEAIITVKGVSLSSY     71 - 140
LEGLMASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK                    141 - 194
//

Text Mined References (7)

PMID Year Title