Property Summary

NCBI Gene PubMed Count 118
PubMed Score 314.97
PubTator Score 236.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
ulcerative colitis 2.200 2.3e-06
gastric cancer 1.700 5.5e-04
pancreatic cancer 1.400 8.9e-04
psoriasis 1.900 6.2e-03
osteosarcoma 1.181 7.8e-05
glioblastoma 1.100 1.8e-04
cystic fibrosis 2.464 7.1e-07
primary pancreatic ductal adenocarcinoma 1.456 9.4e-04
adult high grade glioma 1.300 1.2e-03
pilocytic astrocytoma 1.200 1.7e-05
primary Sjogren syndrome 1.700 1.0e-03
pancreatic carcinoma 1.100 2.7e-02
lung carcinoma -1.400 4.8e-08
spina bifida -1.297 4.0e-02
mucosa-associated lymphoid tissue lympho... 1.740 2.0e-02
invasive ductal carcinoma 1.200 2.8e-02
acute myeloid leukemia 2.300 5.0e-02
ovarian cancer 1.500 3.4e-02

 GO Component (2)

Protein-protein Interaction (6)

Gene RIF (108)

PMID Text
26530011 The interaction between EBV-miR-BHRF1-2 and PRDM1 may be one of the mechanisms by which EBV-miRBHRF1-2 promotes Epstein-Barr virus lymphomagenesis.
26475096 Our findings suggest a previously unrecognized role of PRDM1 and human parvovirus B19 in the pathogenesis of Hashimoto thyroiditis
26431332 KLF4, together with BLIMP1, plays a critical role in mediating lytic Epstein-Barr virus reactivation in epithelial cells.
26310579 Blimp-1 regulates the transcription of CS1 gene in NK and B cell lines from multiple myeloma and diffuse large B cell lymphoma patients.
26221594 heterozygous deletion of 6q21 and/or PRDM1 was frequently detected in extranodal NK/T cell lymphoma, nasal type and correlated with downregulation of PRDM1.
26212250 Data show that vascular endothelial growth factor (VEGF) upregulates the transcription repressor PRD1-BF1 protein in endothelial cells.
26206802 Antineoplastic effects of liposomal short interfering RNA treatment targeting BLIMP1/PRDM1 in primary effusion lymphoma.
26146066 level of Blimp-1 mRNA in the monocytes from patients with active tuberculosis and latent tuberculosis infection subjects was down-regulated
26054109 peritoneal fluid mRNA level significantly elevated in endometriosis
25826676 Blimp-1 expression in dendritic cells can alter an innate inflammatory response by modulating the activation of myeloid cells
25713110 Positional mapping of PRKD1, NRP1 and PRDM1 as novel candidate disease genes in truncus arteriosus
25710909 the transcriptional repressor, Blimp-1, is an intrinsic factor that predisposes CD4(+) memory T cells to latent HIV-1 infection.
25710909 BLIMP-1 inhibits basal HIV-1 transcription as well as transcription in the presence of HIV-1 Tat in Jurkat cells and primary human CD4+ T cells
25487076 aberrant methylation silencing of PRDM1alpha and hypomethylation activation of PRDM1beta are frequent events in DLBCL.
25410866 Authors conclude that BLIMP1 expression is both necessary and sufficient to induce Epstein-Barr virus lytic replication in many (possibly all) latently infected epithelial-cell types, but in only a subset of B-cell types.
25382611 results expand the spectrum of lymphoid malignancies in which PRDM1 may have a tumor suppressor role and identify an epigenetic event that likely contributes to the pathogenesis of BL.
25263394 study gives no definite evidence for a pathogenic genetic link of periodontitis and RA but suggests IRF5 and PRDM1 as shared susceptibility factors.
24841128 BLIMP-1 inhibits basal HIV-1 transcription as well as transcription in the presence of HIV-1 Tat in Jurkat cells and primary human CD4+ T cells
24804861 These data suggest that Blimp-1 might be involved in controlling the HIV reservoirs in the key central-memory T-cell subset.
24796719 Blimp1-deficient effector T cells fail to produce IL-10, and deficiency in Tr-1 cell function leads to uncontrolled Th17 cell-driven CNS pathology without the need to stabilize the Th17 phenotype with IL-23
24637363 The failure of chronic lymphocytic leukemia cells to express or induce PRDM1 correlates with anergy.
24527393 our results demonstrate that PRDM1 serves as a molecular switch to modulate the divergence of neural or germline fates through repression of SOX2 during human development.
24438193 Downregulation of the tumour suppressor PRDM1 in extranodal NK/T-cell lymphoma, nasal type, is mediated by miR-223.
24306881 Single nucleotide polymorphism in PRDM1 gene is associated with Hodgkin disease therapy induced second malignancy.
24009228 Studies indicate that The oncogenic events leading to MYC up-regulation seem to overcome the inhibitory effect of physiological repressors such as BCL6 or BLIMP1.
24004669 In vitro and in vivo experiments showed that that PRDM1 is a tumor suppressor gene in anaplastic large T-cell lymphoma models, likely acting as an antiapoptotic agent.
23977359 miR-23a and miR-125b, proved to be negatively associated with up-modulation of Blimp-1 occurring during IFN-alpha-driven dendritic cell differentiation.
23911415 Data indicate that B lymphocyte induced maturation protein 1 (Blimp1) mRNA expression level was 2.1 times greater in the SLE group as compared to the control group.
23624108 Two missense SNPs, chr6:106659789 (Ser354Asn) and chr6:106660076 (Leu450Phe) at PRDM1 on chromosome 6q21, were significantly associated with Crohn's disease and ulcerative colitis.
23348703 found that PRDM1 was a direct target of miR-30a-5p, and PRDM1 dysfunction was attributable to miR-30a-5p-mediated repression
23129528 Blimp-1 levels are translationally regulated by microRNA-9 (miR-9).
23028907 A parent-of-origin effect in inflammatory bowel diseases was observed for single nucleotide polymorphisms in IL12B, PRDM1, and IL10.
22634616 BLIMP-1 and STAT3 constitute an incoherent feed-forward loop downstream of interleukin (IL)-21 that can coordinate microRNA with mRNA expression during plasma cell differentiation.
22593617 B-cell receptor stimulation induced ERK1/2 activation and upregulation of BLIMP1 mRNA expression in B cells
22585398 data provide evidence that abundance of Blimp-1, and consequently the secretion of proinflammatory cytokines such as IL-2, is regulated in 2 ways: (i)transcriptional regulation by activation of CD4( )T cells and (ii) posttranscriptional regulation by enhanced miR-9 expression
22580854 loss of BLIMP1alpha as an important step in the pathogenesis of the Epstein-Barr virus (EBV) associated B cell lymphomas
22438909 Blimp1 is a mediator of Ras/Raf/AP-1 signaling that promotes cell migration, and is repressed by LOX-PP in lung cancer.
22278826 The authors show that expression of the Epstein-Barr virus immediate-early protein BZLF1 is restricted to Blimp1-positive epithelial cells in oral hairy leukoplakia.
22143801 Disruption of homeostatic control by PRDM1 may be an important pathogenetic mechanism for natural killer cell lymphoma.
22040493 Results showed no involvement of rs548234 at PRDM1-ATG5 region in the susceptibility or clinical relevance of RA in Chinese Han population.
22020966 results reveal a CD99-miR-9-PRDM1 molecule axis in lymphomagenesis of cHL and suggest that upregulation of CD99 in H/RS cells induces terminal B-cell differentiation, which may provide a novel therapeutic strategies for cHL
21785431 PRDM1 is implicated in the etiology of therapy-induced second malignancies after Hodgkin's lymphoma.
21722636 SUMOylation of Blimp-1 regulates its intracellular stability.
21722313 Data suggest that PRDM1 directly regulates both HGAL and LMO2--overexpression of PRDM1 down-regulates HGAL and LMO2; PRDM1 directly binds to promoters of both HGAL and LMO2 and represses genetic transcription.
21690554 FOXO3 and PRDM1 are tumor-suppressor gene candidates in NK-cell neoplasms.
21622776 study demonstrated that polymorphisms in the intergenic region of PRDM1-ATG5 were associated with systemic lupus erythematosus susceptibility in a Chinese population
21411757 LMP-1 expression in progenitor germinal center B cells could contribute to the pathogenesis of EBV-associated lymphomas by down-regulating BLIMP1alpha, in turn preventing plasma cell differentiation and induction of the viral lytic cycle.
21216962 Positive regulatory domain I (PRDM1) and IRF8/PU.1 counter-regulate MHC class II transactivator (CIITA) expression during dendritic cell maturation.
21103670 Data show that Blimp-1 expression was directly proportional to the expression of the negative costimulatory molecules.
20966935 demonstrate that the miR-30 family directly controls BCL-6 expression and miR-9-1 and let-7a directly control PRDM-1 expression through targeting their 3'UTR, mediating the follicular dendritic cells effect
20944005 these data demonstrate a key role for PRDM1 in the negative regulation of NK activation
20859709 PRDM1beta expression differed in B-lymphoma cells and corresponded to the methylation status of the PRDM1beta promoter.
20800019 A high level of Blimp-1 expression in diffuse large B-cell lymphoma was associated with a significantly shorter overall survival.
20530581 PRDM1 is an essential component of the apoptotic response in mantle cell lymphoma and a potential important marker for the effectiveness of bortezomib therapy.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20047096 Blimp-1 is located in chromosome 6q21-22.1, a region frequently deleted in several tumors including lymphoid malignancies and has been supposed to be a candidate of tumor suppressor gene
19915048 PPARgamma ligands alone or combined with 9-cis-retinoic acid enhanced CpG-induced expression of Cox-2 and the plasma cell transcription factor BLIMP-1.
19898481 Genetic variants at PRDM1, is associated with rheumatoid arthritis risk
19898481 Observational study of gene-disease association. (HuGE Navigator)
19838195 identified five new systemic lupus erythematosus susceptibility loci (P < 5 x 10(-8)): TNIP1 (odds ratio (OR) = 1.27), PRDM1 (OR = 1.20), JAZF1 (OR = 1.20), UHRF1BP1 (OR = 1.17) and IL10 (OR = 1.19).
19838195 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19828640 A direct link exists between B cell receptor cross-linking and transcriptional activation of positive regulatory domain I-binding factor 1 (PRDI-BF1).
19828629 By binding to interferon-responsive sites in the indoleamine 2,3-dioxygenase (IDO1) promoter, BLIMP-1 acts in a negative feedback loop to successfully balance the outcome of tolerance vs inflammation.
19788443 The reported expression pattern is difficult to reconcile with a function of Blimp-1 as a marker for sebocytic progenitor cells but indicates a major role in terminal differentiation.
19760754 Observational study of gene-disease association. (HuGE Navigator)
19735688 polymorphisms studied in the PRDM1 and XBP1 genes do not seem to be involved in immunoglobulin A deficiency predisposition in the Spanish population.
19735688 Observational study of gene-disease association. (HuGE Navigator)
19717648 C/EBPbeta directly bound to the promoter region of IRF4, BLIMP1, and BCL2.
19563034 Low dose 2-methoxyestradiol can up-regulate the expression of PRDMlalpha and PRDM1beta in myeloma cells.
19530237 Data provide evidence that hsa-miR-127 is involved in B-cell differentiation process through posttranscriptional regulation of BLIMP1 and XBP1.
19460752 Knockdown of PR domain containing 1, with ZNF domain (PRDM1; BLIMP1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19433448 the induction of Blimp1 represents a novel mechanism whereby the RelB NF-kappaB subunit mediates repression, specifically of ERalpha, thereby promoting a more migratory phenotype in breast cancer cells
19269192 regulates the contraction phase of CD8+ T cell response via IL-2 transcription inhibition
19234190 Blimp-1 is a key regulator of Toll-like receptor-mediated and differentiation-associated reduction of nucleotide-binding domain, leucine-rich repeat family pyrin domain-containing (NLRP)12 protein in human myeloid-monocytic cells.
19194464 tumor-promoting effect of deletion in 6q21, that included genes PRDM1, ATG5 and AIM1
19047678 GC-enriched hsa-miR-125b down-regulates the expression of IRF4 and PRDM1/BLIMP1, and memory B cell-enriched hsa-miR-223 down-regulates the expression of LMO2.
18992153 BLIMP1 and PRMT5 were expressed and arginine dimethylation of histones H2A and H4 was detected in human male gonocytes and intratubular germ cell neoplasia unclassified and most seminomas, while downregulated in embryonal carcinoma.
18845144 Blimp-1Delta7 interferes with endogenous Blimp-1 expression, suggesting an auto-regulatory mechanism of Blimp-1 activation.
18604866 the basal activity of the human PRDM1 promoter, through which several factors, including SP1, SP3 and early growth response 1, modulate its expression through a conserved GC-box.
18596541 PRDM1 may be a tumor suppressor in some primary central nervous system lymphoma and contribute to lymphomagenesis by impairing terminal differentiation
18583325 MiRNA-mediated down-regulation of PRDM1/Blimp-1 may contribute to the phenotype maintenance and pathogenesis of Hodgkin/Reed-Sternberg cells
18552212 By chromatin immunoprecipitation and assays using an inducible Spi-B construct BLIMP1 and XBP-1 were identified as direct target genes of Spi-B mediated repression.
18370921 In spite of some commonalities, different targets and regulators of Blimp-1 in B and T cells suggest intriguing evolutionary divergence of this regulatory machinery.
18354204 STAT3 activation functionally mimicked IL-21 treatment and that STAT3-mediated BLIMP1 up-regulation occurred despite high BCL6 expression levels
18256039 reporter assays demonstrated that Bach2 and Bcl6 cooperate to repress Prdm1 through its intron enhancer region
18235046 bortezomib down-regulation of PRDM1beta preceded decreased IRF4 and c-MYC expression
18192112 that transcription factors Xbp-1, Blimp-1, and PAX-5-encoded BSAP play important roles in the regulation of plasmacytic differentiation and exert their effects on differentiation induced by low 2ME2 concentrations
18089822 Blimp-1 ensures the survival of transformed plasma cells.
18071884 Blimp-1 expression is controlled by the same cgammaC cytokines that regulate T cell homeostasis suggesting a direct link between the extrinsic and intrinsic arms of the process.
17877160 Blimp-1 could directly repress the expression of c-myc in 2ME2-mediated differentiation induction of multiple myeloma cells.
17682124 Repression of PRDM1 by BSAP reveals an autoregulatory negative-feedback loop that could play a relevant role in controlling human PC differentiation.
17379744 both PRDM1alpha and PRDM1beta transcripts were expressed in microdissected lymphoma cells only in the non-germinal center B-cell-like (non-GCB) subtype of DLBCL
17264218 Suppression of p53 transcription is a crucial function of endogenous BLIMP1 and is essential for normal cell growth.
17213024 Altered expression of BLIMP1 may cause neoplastic B-cell proliferation; BLIMP1 is a pivotal molecule in the pathogenesis of diffuse large B-cell lymphoma.
17043021 Normal human plasma cells have significantly lower levels of PRDI-BF1beta expression than plasma cells isolated from multiple myeloma patients.
16849320 Results identify Viperin as a tightly regulated ISGF3 target gene, which is counter-regulated by PRDI-BF1.
16765445 In addition to silencing expression of major histocompatibility class II transactivator protein (CIITA) promoter III in B lymphocytes, PRDI-BF1 is capable of binding and suppressing CIITA promoter type IV.
16585013 diffuse large B-cell lymphoma cases with increased PRDM1 expression co-expressed BCL-6 and MUM1/IRF4, confirming that PRDM1 expression is insufficient to drive the full genetic program associated with plasmacytic differentiation
16547239 tetanus toxoid (tet) (+) plasma cell (PC)expressed several times more positive regulatory domain I- binding factor 1/B lymphocyte-induced maturation protein 1 transcription factor than the tetC(-) PC
16492805 Blimp1 is a tumor suppressor gene, whose inactivation may contribute to lymphomagenesis by blocking post-germinal center differentiation of B cells toward plasma cells.
16424392 identifies PRDM1 inactivation as a recurrent genetic defect in diffuse large B-cell lymphomas cells and establishes PRDM1 as a potential tumor suppressor gene.
16002735 Transcriptional regulator PRD1-BF1 governing B-cell terminal cellular differentiation provides multiple myeloma- and other tumor- and nonmalignant-associated cytotoxic T-lymphocyte epitopes.
14985713 PRDI-BF1 mediates silencing of interferon-beta gene transcription via recruitment of the histone H3 methyltransferase G9a.
12626569 PRDI-BF1 beta is abundantly expressed in myeloma cell lines through alternative transcription initiation, has a disrupted PR domain and a significantly impaired transcription repressor function on multiple target genes.
12453881 Premature Blimp-1 expression coupled to altered and deficient Pax5 expression causes some proliferating B cells to prematurely differentiate to plasma cells in MM.
12165517 BCL-6 regulates the Blimp-1 promoter through a novel mechanism involving AP-1 elements.
12150891 Blimp-1 orchestrates plasma cell differentiation by extinguishing the mature B cell gene expression program
11877292 were expressed by human PCs following a gradient of increasing maturity in the direction: tonsil-->blood-->BM

AA Sequence

MLDICLEKRVGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSG      1 - 70
ADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYS     71 - 140
RGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHY    141 - 210
PYPGELTMMNLTQTQSSLKQPSTEKNELCPKNVPKREYSVKEILKLDSNPSKGKDLYRSNISPLTSEKDL    211 - 280
DDFRRRGSPEMPFYPRVVYPIRAPLPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSS    281 - 350
SPHSSPGNTVSPVGPGSQEHRDSYAYLNASYGTEGLGSYPGYAPLPHLPPAFIPSYNAHYPKFLLPPYGM    351 - 420
NCNGLSAVSSMNGINNFGLFPRLCPVYSNLLGGGSLPHPMLNPTSLPSSLPSDGARRLLQPEHPREVLVP    421 - 490
APHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHVVQPKATSAAMAAPSSDEAMNLIKNKRNMTGYK    491 - 560
TLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKP    561 - 630
HECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLC    631 - 700
SLKVHLKGNCAAAPAPGLPLEDLTRINEEIEKFDISDNADRLEDVEDDISVISVVEKEILAVVRKEKEET    701 - 770
GLKVSLQRNMGNGLLSSGCSLYESSDLPLMKLPPSNPLPLVPVKVKQETVEPMDP                   771 - 825
//

Text Mined References (122)

PMID Year Title
26530011 2016 EBV-miR-BHRF1-2 targets PRDM1/Blimp1: potential role in EBV lymphomagenesis.
26475096 2015 PRDM1 expression via human parvovirus B19 infection plays a role in the pathogenesis of Hashimoto thyroiditis.
26431332 2015 Differentiation-Dependent KLF4 Expression Promotes Lytic Epstein-Barr Virus Infection in Epithelial Cells.
26310579 2016 Blimp-1/PRDM1 regulates the transcription of human CS1 (SLAMF7) gene in NK and B cells.
26221594 2015 The Genetic Deletion of 6q21 and PRDM1 and Clinical Implications in Extranodal NK/T Cell Lymphoma, Nasal Type.
26212250 2015 VEGF-Mediated Induction of PRD1-BF1/Blimp1 Expression Sensitizes Tumor Vasculature to Oncolytic Virus Infection.
26206802 2015 Antineoplastic effects of liposomal short interfering RNA treatment targeting BLIMP1/PRDM1 in primary effusion lymphoma.
26146066 2015 [Down-regulated expression of Blimp-1 mRNA in monocytes from patients with active tuberculosis].
26054109 2015 Decreased Bcl-6 and increased Blimp-1 in the peritoneal cavity of patients with endometriosis.
25826676 2015 Expression of Blimp-1 in dendritic cells modulates the innate inflammatory response in dextran sodium sulfate-induced colitis.
25713110 2015 Positional mapping of PRKD1, NRP1 and PRDM1 as novel candidate disease genes in truncus arteriosus.
25710909 2015 Blimp-1, an intrinsic factor that represses HIV-1 proviral transcription in memory CD4+ T cells.
25487076 2015 Methylation contributes to imbalance of PRDM1?/PRDM1b? expression in diffuse large B-cell lymphoma.
25410866 2015 Cellular differentiation regulator BLIMP1 induces Epstein-Barr virus lytic reactivation in epithelial and B cells by activating transcription from both the R and Z promoters.
25382611 2014 Hypermethylation of the tumor suppressor gene PRDM1/Blimp-1 supports a pathogenetic role in EBV-positive Burkitt lymphoma.
25263394 2014 A large candidate-gene association study suggests genetic variants at IRF5 and PRDM1 to be associated with aggressive periodontitis.
24968003 2014 BLMP-1/Blimp-1 regulates the spatiotemporal cell migration pattern in C. elegans.
24804861 2014 Blimp-1 overexpression is associated with low HIV-1 reservoir and transcription levels in central memory CD4+ T cells from elite controllers.
24796719 2014 IL-27 and IL-12 oppose pro-inflammatory IL-23 in CD4+ T cells by inducing Blimp1.
24637363 2014 Variable induction of PRDM1 and differentiation in chronic lymphocytic leukemia is associated with anergy.
24613396 2014 DRE-1/FBXO11-dependent degradation of BLMP-1/BLIMP-1 governs C. elegans developmental timing and maturation.
24527393 2014 Suppression of the SOX2 neural effector gene by PRDM1 promotes human germ cell fate in embryonic stem cells.
24438193 2014 The downregulation of PRDM1/Blimp-1 is associated with aberrant expression of miR-223 in extranodal NK/T-cell lymphoma, nasal type.
24306881 2014 Hodgkin disease therapy induced second malignancy susceptibility 6q21 functional variants in roma and hungarian population samples.
24009228 2013 Understanding MYC-driven aggressive B-cell lymphomas: pathogenesis and classification.
24004669 2013 PRDM1/BLIMP1 is commonly inactivated in anaplastic large T-cell lymphoma.
23977359 2013 IFN-? regulates Blimp-1 expression via miR-23a and miR-125b in both monocytes-derived DC and pDC.
23911415 2013 Up-regulation of transcription factor Blimp1 in systemic lupus erythematosus.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23624108 2013 Association between variants of PRDM1 and NDP52 and Crohn's disease, based on exome sequencing and functional studies.
23348703 2013 PRDM1 is directly targeted by miR-30a-5p and modulates the Wnt/?-catenin pathway in a Dkk1-dependent manner during glioma growth.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23129528 2013 The microRNA-9/B-lymphocyte-induced maturation protein-1/IL-2 axis is differentially regulated in progressive HIV infection.
23028907 2012 Limited evidence for parent-of-origin effects in inflammatory bowel disease associated loci.
22634616 2012 BLIMP-1 and STAT3 counterregulate microRNA-21 during plasma cell differentiation.
22593617 2012 B cell receptor-ERK1/2 signal cancels PAX5-dependent repression of BLIMP1 through PAX5 phosphorylation: a mechanism of antigen-triggering plasma cell differentiation.
22585398 2012 miR-9 enhances IL-2 production in activated human CD4(+) T cells by repressing Blimp-1.
22580854 2012 BLIMP1?, the master regulator of plasma cell differentiation is a tumor supressor gene in B cell lymphomas.
22555612 2012 SUMOylation of Blimp-1 is critical for plasma cell differentiation.
22438909 2012 Blimp1 activation by AP-1 in human lung cancer cells promotes a migratory phenotype and is inhibited by the lysyl oxidase propeptide.
22278826 2012 Lytic Epstein-Barr virus infection in epithelial cells but not in B-lymphocytes is dependent on Blimp1.
22143801 2011 PRDM1 is a tumor suppressor gene in natural killer cell malignancies.
22040493 2011 Rs548234 polymorphism at PRDM1-ATG5 region susceptible to rheumatoid arthritis in Caucasians is not associated with rheumatoid arthritis in Chinese Han population.
22020966 2012 CD99 triggers upregulation of miR-9-modulated PRDM1/BLIMP1 in Hodgkin/Reed-Sternberg cells and induces redifferentiation.
21785431 2011 Variants at 6q21 implicate PRDM1 in the etiology of therapy-induced second malignancies after Hodgkin's lymphoma.
21722636 2011 SUMOylation of Blimp-1 promotes its proteasomal degradation.
21722313 2011 PRDM1/Blimp1 downregulates expression of germinal center genes LMO2 and HGAL.
21690554 2011 Identification of FOXO3 and PRDM1 as tumor-suppressor gene candidates in NK-cell neoplasms by genomic and functional analyses.
21622776 2011 Genetic association of PRDM1-ATG5 intergenic region and autophagy with systemic lupus erythematosus in a Chinese population.
21421998 2011 NANOS3 function in human germ cell development.
21411757 2011 Down-regulation of BLIMP1? by the EBV oncogene, LMP-1, disrupts the plasma cell differentiation program and prevents viral replication in B cells: implications for the pathogenesis of EBV-associated B-cell lymphomas.
21216962 2011 Positive regulatory domain I (PRDM1) and IRF8/PU.1 counter-regulate MHC class II transactivator (CIITA) expression during dendritic cell maturation.
21103670 Expression of a broad array of negative costimulatory molecules and Blimp-1 in T cells following priming by HIV-1 pulsed dendritic cells.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20966935 2011 Follicular dendritic cell-induced microRNA-mediated upregulation of PRDM1 and downregulation of BCL-6 in non-Hodgkin's B-cell lymphomas.
20944005 2010 PRDM1/Blimp-1 controls effector cytokine production in human NK cells.
20859709 2010 Loss of promoter methylation contributes to the expression of functionally impaired PRDM1? isoform in diffuse large B-cell lymphoma.
20800019 2010 Blimp-1 protein and Hans classification on prognosis of diffuse large B-cell lymphoma and their interrelation.
20530581 2010 PRDM1 is required for mantle cell lymphoma response to bortezomib.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20047096 2010 Blimp-1 is a tumor suppressor gene in lymphoid malignancies.
19915048 2009 Peroxisome proliferator-activated receptor gamma ligands enhance human B cell antibody production and differentiation.
19898481 2009 Genetic variants at CD28, PRDM1 and CD2/CD58 are associated with rheumatoid arthritis risk.
19838195 2009 A large-scale replication study identifies TNIP1, PRDM1, JAZF1, UHRF1BP1 and IL10 as risk loci for systemic lupus erythematosus.
19838193 2009 Genome-wide association study in a Chinese Han population identifies nine new susceptibility loci for systemic lupus erythematosus.
19828640 2009 PU.1 regulates positive regulatory domain I-binding factor 1/Blimp-1 transcription in lymphoma cells.
19828629 2009 Amino acid deprivation links BLIMP-1 to the immunomodulatory enzyme indoleamine 2,3-dioxygenase.
19788443 2010 Blimp-1: a marker of terminal differentiation but not of sebocytic progenitor cells.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19735688 2009 Lack of evidence of a role of XBP1 and PRDM1 polymorphisms in Spanish patients with immunoglobulin A deficiency.
19717648 2009 C/EBPbeta regulates transcription factors critical for proliferation and survival of multiple myeloma cells.
19563034 2009 [Effect of low-dose 2-methoxyestradiol on the expressions of two isoforms of PRDM1 gene in myeloma].
19530237 2010 B-cell differentiation in EBV-positive Burkitt lymphoma is impaired at posttranscriptional level by miRNA-altered expression.
19433448 2009 RelB NF-kappaB represses estrogen receptor alpha expression via induction of the zinc finger protein Blimp1.
19269192 2009 Surviving the crash: transitioning from effector to memory CD8+ T cell.
19234190 2009 Blimp-1/PRDM1 mediates transcriptional suppression of the NLR gene NLRP12/Monarch-1.
19194464 2009 Genomic analyses reveal global functional alterations that promote tumor growth and novel tumor suppressor genes in natural killer-cell malignancies.
19047678 2009 Differentiation stage-specific expression of microRNAs in B lymphocytes and diffuse large B-cell lymphomas.
18992153 2008 Expression of BLIMP1/PRMT5 and concurrent histone H2A/H4 arginine 3 dimethylation in fetal germ cells, CIS/IGCNU and germ cell tumors.
18845144 2008 Blimp-1Deltaexon7: a naturally occurring Blimp-1 deletion mutant with auto-regulatory potential.
18604866 2008 Transcription of PRDM1, the master regulator for plasma cell differentiation, depends on an SP1/SP3/EGR-1 GC-box.
18596541 2008 Recurrent inactivation of the PRDM1 gene in primary central nervous system lymphoma.
18583325 2008 MicroRNA-mediated down-regulation of PRDM1/Blimp-1 in Hodgkin/Reed-Sternberg cells: a potential pathogenetic lesion in Hodgkin lymphomas.
18552212 2008 Spi-B inhibits human plasma cell differentiation by repressing BLIMP1 and XBP-1 expression.
18400362 2008 Gene expression profiles of Hodgkin's lymphoma cell lines with different sensitivity to cytotoxic drugs.
18370921 2008 Regulation and functions of Blimp-1 in T and B lymphocytes.
18354204 2008 STAT3-mediated up-regulation of BLIMP1 Is coordinated with BCL6 down-regulation to control human plasma cell differentiation.
18256039 2008 Regulation of the plasma cell transcription factor Blimp-1 gene by Bach2 and Bcl6.
18235046 2008 PRDM1 is involved in chemoresistance of T-cell lymphoma and down-regulated by the proteasome inhibitor.
18192112 2007 Transcription factors Xbp-1, Blimp-1, and BSAP are involved in the regulation of plasmacytic differentiation induced by 2-methoxyestradiol in myeloma cell lines.
18089822 2007 Induction of apoptosis in plasma cells by B lymphocyte-induced maturation protein-1 knockdown.
18071884 2008 Blimp-1 connects the intrinsic and extrinsic regulation of T cell homeostasis.
17877160 2007 [Regulation of c-myc expression by Blimp-1 during the differentiation of myeloma cells].
17682124 2007 Human BSAP and BLIMP1 conform an autoregulatory feedback loop.
17379744 2007 Rituximab plus CHOP (R-CHOP) overcomes PRDM1-associated resistance to chemotherapy in patients with diffuse large B-cell lymphoma.
17264218 2007 BLIMP1 regulates cell growth through repression of p53 transcription.
17213024 2007 Novel BLIMP1/PRDM1 gene mutations in B-cell lymphoma.
17043021 2006 The expression of PRDI-BF1 beta isoform in multiple myeloma plasma cells.
16849320 2006 Toll-like receptor-dependent and -independent viperin gene expression and counter-regulation by PRDI-binding factor-1/BLIMP1.
16765445 2007 Positive regulatory domain I-binding factor 1 mediates repression of the MHC class II transactivator (CIITA) type IV promoter.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16585013 2006 PRDM1/BLIMP-1 expression in multiple B and T-cell lymphoma.
16547239 2006 Immunization-induced perturbation of human blood plasma cell pool: progressive maturation, IL-6 responsiveness, and high PRDI-BF1/BLIMP1 expression are critical distinctions between antigen-specific and nonspecific plasma cells.
16492805 2006 Inactivation of the PRDM1/BLIMP1 gene in diffuse large B cell lymphoma.
16424392 2006 Mutational analysis of PRDM1 indicates a tumor-suppressor role in diffuse large B-cell lymphomas.
16002735 2005 Targeting positive regulatory domain I-binding factor 1 and X box-binding protein 1 transcription factors by multiple myeloma-reactive CTL.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14985713 2004 PRDI-BF1 recruits the histone H3 methyltransferase G9a in transcriptional silencing.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12626569 2003 Identification of a functionally impaired positive regulatory domain I binding factor 1 transcription repressor in myeloma cell lines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453881 2002 Altered mRNA expression of Pax5 and Blimp-1 in B cells in multiple myeloma.
12165517 2002 Repression of AP-1 function: a mechanism for the regulation of Blimp-1 expression and B lymphocyte differentiation by the B cell lymphoma-6 protooncogene.
12150891 2002 Blimp-1 orchestrates plasma cell differentiation by extinguishing the mature B cell gene expression program.
11877292 2002 The heterogeneity shown by human plasma cells from tonsil, blood, and bone marrow reveals graded stages of increasing maturity, but local profiles of adhesion molecule expression.
11342629 2001 Stage-specific modulation of IFN-regulatory factor 4 function by Krüppel-type zinc finger proteins.
11067898 2000 Commitment of B lymphocytes to a plasma cell fate is associated with Blimp-1 expression in vivo.
9887105 1999 PRDI-BF1/Blimp-1 repression is mediated by corepressors of the Groucho family of proteins.
8921366 1996 The B-lymphocyte maturation promoting transcription factor BLIMP1/PRDI-BF1 maps to D6S447 on human chromosome 6q21-q22.1 and the syntenic region of mouse chromosome 10.
8168136 1994 Blimp-1, a novel zinc finger-containing protein that can drive the maturation of B lymphocytes into immunoglobulin-secreting cells.
8033216 1994 Blimp-1 is the murine homolog of the human transcriptional repressor PRDI-BF1.
1851123 1991 Identification and characterization of a novel repressor of beta-interferon gene expression.