Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.780 1.4e-02
active ulcerative colitis 1.343 2.6e-02
ductal carcinoma in situ -2.000 6.9e-04
invasive ductal carcinoma -2.300 2.5e-03
ovarian cancer 1.600 2.4e-04

Synonym

Accession A1A4F0 C9JP04 C9JXB5 Q8N6Q6
Symbols C3orf55

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MKVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCWIGGDLTNFKGCYLTNQLPI      1 - 70
QIFTAIFDMNTDVIILSQFMYYRLKNQKKKMIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR          71 - 135
//

Text Mined References (6)

PMID Year Title
22363504 2012 Cystinosin, MPDU1, SWEETs and KDELR belong to a well-defined protein family with putative function of cargo receptors involved in vesicle trafficking.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.