Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.09
PubTator Score 5.59

Knowledge Summary


No data available


  Differential Expression (14)

Gene RIF (4)

24596207 The PP2A regulatory subunit PPP2R2D inhibits T-cell proliferation and survival within tumors.
22539979 The -462 G>A variant of PPP2R2D affects NF1 binding to the proximal promoter of PPP2R2D.
22174317 HIV-1 Rev interacting protein, protein phosphatase 2, regulatory subunit B, delta (PPP2R2D), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
18697906 These highly related members of the same subfamily of PP2A regulatory subunits differentially regulate TGF-beta/Activin/Nodal signalling to elicit opposing biological outcomes.

AA Sequence

FNKKILHTAWHPVDNVIAVAATNNLYIFQDKIN                                         421 - 453

Text Mined References (9)

PMID Year Title
24596207 2014 An in vivo screen implicates PPP2R2D as an inhibitor of T-cell function.
22539979 2012 Identification and functional analysis of variant haplotypes in the 5'-flanking region of protein phosphatase 2A-B? gene.
18697906 2008 Two highly related regulatory subunits of PP2A exert opposite effects on TGF-beta/Activin/Nodal signalling.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.