Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.10
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 4.0e-03
astrocytic glioma -1.100 5.0e-02
atypical teratoid / rhabdoid tumor -1.800 3.7e-07
glioblastoma -1.700 2.1e-05
medulloblastoma -1.200 2.6e-03
medulloblastoma, large-cell -1.800 1.3e-04
osteosarcoma 1.087 5.9e-03
ovarian cancer -1.900 1.7e-08
pituitary cancer 1.200 1.3e-04

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MASAELQGKYQKLAQEYSKLRAQNQVLKKGVVDEQANSAALKEQLKMKDQSLRKLQQEMDSLTFRNLQLA      1 - 70
KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENERLHIQFFEADEQHKHVEAEL     71 - 140
RSRLATLETEAAQHQAVVDGLTRKYMETIEKLQNDKAKLEVKSQTLEKEAKECRLRTEECQLQLKTLHED    141 - 210
LSGRLEESLSIINEKVPFNDTKYSQYNALNVPLHNRRHQLKMRDIAGQALAFVQDLVTALLNFHTYTEQR    211 - 280
IQIFPVDSAIDTISPLNQKFSQYLHENASYVRPLEEGMLHLFESITEDTVTVLETTVKLKTFSEHLTSYI    281 - 350
CFLRKILPYQLKSLEEECESSLCTSALRARNLELSQDMKKMTAVFEKLQTYIALLALPSTEPDGLLRTNY    351 - 420
SSVLTNVGAALHGFHDVMKDISKHYSQKAAIEHELPTATQKLITTNDCILSSVVALTNGAGKIASFFSNN    421 - 490
LDYFIASLSYGPKAASGFISPLSAECMLQYKKKAAAYMKSLRKPLLESVPYEEALANRRILLSSTESREG    491 - 560
LAQQVQQSLEKISKLEQEKEHWMLEAQLAKIKLEKENQRIADKLKNTGSAQLVGLAQENAAVSNTAGQDE    561 - 630
ATAKAVLEPIQSTSLIGTLTRTSDSEVPDVESREDLIKNHYMARIVELTSQLQLADSKSVHFYAECRALS    631 - 700
KRLALAEKSKEALTEEMKLASQNISRLQDELTTTKRSYEDQLSMMSDHLCSMNETLSKQREEIDTLKMSS    701 - 770
KGNSKKNKSR                                                                771 - 780
//

Text Mined References (7)

PMID Year Title