Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.19
PubTator Score 6.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
glioblastoma 1.900 1.7e-05
osteosarcoma 1.200 7.0e-04
group 3 medulloblastoma 1.900 2.3e-05
atypical teratoid / rhabdoid tumor 1.300 1.2e-04
primitive neuroectodermal tumor 1.500 1.5e-04
Duchenne muscular dystrophy 1.025 5.6e-09
juvenile dermatomyositis 1.258 2.4e-11
primary pancreatic ductal adenocarcinoma 1.705 8.8e-03
interstitial cystitis 1.300 2.1e-02
pediatric high grade glioma 1.900 7.3e-08
pilocytic astrocytoma 2.300 3.8e-13
posterior fossa group A ependymoma 1.200 6.0e-08
primary Sjogren syndrome 1.200 3.8e-04
subependymal giant cell astrocytoma 1.469 1.1e-02
lung carcinoma -1.200 6.2e-19
gastric carcinoma 1.300 2.4e-02
ulcerative colitis 2.000 3.8e-06
ovarian cancer 1.500 1.2e-03
pancreatic cancer 1.700 5.2e-03

Gene RIF (4)

PMID Text
21804078 phostensin is a ubiquitous protein in leukocytes, and it may play an important role in modulating the cellular functions of leukocytes.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19622346 phostensin is an actin filament pointed end-capping protein that is capable of modulating actin dynamics.
17374523 our data shows that phostensin targets PP1 to F-actin cytoskeleton.

AA Sequence

MATIPDWKLQLLARRRQEEASVRGREKAERERLSQMPAWKRGLLERRRAKLGLSPGEPSPVLGTVEAGPP      1 - 70
DPDESAVLLEAIGPVHQNRFIRQERQQQQQQQQRSEELLAERKPGPLEARERRPSPGEMRDQSPKGRESR     71 - 140
EERLSPRETRERRLGIGGAQELSLRPLEARDWRQSPGEVGDRSSRLSEAWKWRLSPGETPERSLRLAESR    141 - 210
EQSPRRKEVESRLSPGESAYQKLGLTEAHKWRPDSRESQEQSLVQLEATEWRLRSGEERQDYSEECGRKE    211 - 280
EWPVPGVAPKETAELSETLTREAQGNSSAGVEAAEQRPVEDGERGMKPTEGWKWTLNSGKAREWTPRDIE    281 - 350
AQTQKPEPPESAEKLLESPGVEAGEGEAEKEEAGAQGRPLRALQNCCSVPSPLPPEDAGTGGLRQQEEEA    351 - 420
VELQPPPPAPLSPPPPAPTAPQPPGDPLMSRLFYGVKAGPGVGAPRRSGHTFTVNPRRSVPPATPATPTS    421 - 490
PATVDAAVPGAGKKRYPTAEEILVLGGYLRLSRSCLAKGSPERHHKQLKISFSETALETTYQYPSESSVL    491 - 560
EELGPEPEVPSAPNPPAAQPDDEEDEEELLLLQPELQGGLRTKALIVDESCRR                     561 - 613
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24434620 2014 Identification of the high molecular weight isoform of phostensin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21804078 2011 Immunolocalization of phostensin in lymphatic cells and tissues.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19622346 2009 Phostensin caps to the pointed end of actin filaments and modulates actin dynamics.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17374523 2007 Identification of phostensin, a PP1 F-actin cytoskeleton targeting subunit.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.