Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.19
PubTator Score 9.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma -2.900 1.5e-03
ependymoma -4.500 2.3e-28
oligodendroglioma -2.300 1.6e-15
cutaneous lupus erythematosus 1.200 3.4e-02
glioblastoma -4.500 7.2e-09
osteosarcoma -2.416 1.0e-04
group 4 medulloblastoma -4.900 1.9e-11
atypical teratoid / rhabdoid tumor -5.000 4.1e-14
medulloblastoma, large-cell -4.300 2.7e-04
primitive neuroectodermal tumor -3.700 1.3e-07
tuberculosis -1.100 1.4e-04
non-small cell lung cancer -1.462 2.7e-16
lung cancer -1.500 4.4e-04
interstitial cystitis 2.300 5.4e-04
pediatric high grade glioma -4.000 5.0e-11
pilocytic astrocytoma -2.200 5.6e-05
primary Sjogren syndrome 1.600 1.6e-03
subependymal giant cell astrocytoma -3.581 1.9e-03
invasive ductal carcinoma -1.400 1.1e-02
ulcerative colitis 1.700 1.2e-03

Gene RIF (6)

PMID Text
26497934 ROCK phosphorylated eEF1A1 is a novel substrate for TIMAP-PP1 underlining the complex regulatory role of TIMAP in the endothelium.
25007873 TIMAP promotes angiogenesis by suppressing PTEN-mediated Akt inhibition in human glomerular endothelial cells.
21907835 These data confirmed the barrier-protective role of TIMAP
21466834 Data suggest that double-thiophosphorylation of TIMAP has minor effect on its binding ability to PP1c, but considerably attenuates its inhibitory effect on the activity of PP1c.
18586956 involvement of TIMAP in PKA-mediated moesin dephosphorylation and the importance of this dephosphorylation in TIMAP-mediated endothelial cell barrier protection
12055102 TIMAP, a novel CAAX box protein regulated by TGF-beta1 and expressed in endothelial cells.

AA Sequence

MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRRKKVSFEASV      1 - 70
ALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHA     71 - 140
AATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRVAPEQQMIA    141 - 210
DIHCMIAAGQDLDWIDAQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAEL    211 - 280
LVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKVVRRAS    281 - 350
LSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKIPRGEL    351 - 420
DMPVENGLRAPVSAYQYALANGDVWKVHEVPDYSMAYGNPGVADATPPWSSYKEQSPQTLLELKRQRAAA    421 - 490
KLLSHPFLSTHLGSSMARTGESSSEGKAPLIGGRTSPYSSNGTSVYYTVTSGDPPLLKFKAPIEEMEEKV    491 - 560
HGCCRIS                                                                   561 - 567
//

Text Mined References (17)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26497934 2015 Elongation factor-1A1 is a novel substrate of the protein phosphatase 1-TIMAP complex.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25007873 2014 TIMAP promotes angiogenesis by suppressing PTEN-mediated Akt inhibition in human glomerular endothelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21907835 2011 TIMAP protects endothelial barrier from LPS-induced vascular leakage and is down-regulated by LPS.
21466834 2011 Characterization of the effect of TIMAP phosphorylation on its interaction with protein phosphatase 1.
18586956 2008 TIMAP is a positive regulator of pulmonary endothelial barrier function.
16263087 2005 The protein phosphatase-1 targeting subunit TIMAP regulates LAMR1 phosphorylation.
15491607 2004 Alternative splice variants encoding unstable protein domains exist in the human brain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12055102 2002 TIMAP, a novel CAAX box protein regulated by TGF-beta1 and expressed in endothelial cells.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.