Property Summary

NCBI Gene PubMed Count 28
PubMed Score 48.27
PubTator Score 55.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma 1.200 8.6e-05
ependymoma 1.300 3.1e-03
psoriasis -1.400 5.6e-03
group 4 medulloblastoma 1.800 4.8e-08
astrocytoma 1.300 1.4e-03
atypical teratoid / rhabdoid tumor 1.400 1.7e-05
glioblastoma 1.400 1.4e-07
medulloblastoma, large-cell 1.700 1.6e-05
primitive neuroectodermal tumor 1.200 2.1e-06
tuberculosis and treatment for 6 months -2.100 5.7e-06
lung cancer -1.200 3.2e-03
ovarian cancer 1.100 9.2e-04

Gene RIF (18)

PMID Text
26188041 CA expression increases whilst endogeneous PPP1R10 (PNUTS) expression decreases in HIV-1 (NL4-3) infected MOLT-3 cells over time
26188041 PPP1R10 (PNUTS) may downregulate HIV transcription by preventing the assembly of a functional P-TEFb complex (CCNT1-CDK9) (shown to affect HIV-1 transcription)
24591642 PNUTS inhibits the PP1-mediated dephosphorylation of critical substrates, especially retinoblastoma protein, by blocking their binding sites on PP1.
24462707 PNUTS was a valid target of miR-383 and was involved in the inhibition of gammaH2AX.
23117887 our studies reveal PNUTS as a novel PTEN regulator and a likely oncogene.
23110726 CA expression increases whilst endogeneous PPP1R10 (PNUTS) expression decreases in HIV-1 (NL4-3) infected MOLT-3 cells over time
20890310 PNUTS is identified as a new and integral component of the DNA damage response involved in DNA repair.
20516061 mammalian Wdr82 functions in a variety of cellular processes; PTW/PP1 phosphatase complex (PNUTS, Tox4, Wdr82, PP1) has a role in the regulation of chromatin structure during the transition from mitosis into interphase
20372802 stimulation of PP1 activity via siRNA mediated knockdown of its interacting protein PNUTS (Phosphatase Nuclear Targeting Subunit) leads to Rb dephosphorylation and apoptosis in cancer cells
19851445 Observational study of gene-disease association. (HuGE Navigator)
19429178 no evidence found of association between a CAT53 polymorphism and Alzheimer's Disease (AD), but found a significant negative association of the C282Y HFE mutation with AD
19429178 Observational study of gene-disease association. (HuGE Navigator)
19293638 the coordinated spatial and temporal regulation of LCP1 and PNUTS may be a novel mechanism to control the expression of genes that are critical for certain physiological and pathological processes.
18360108 reduced expression of PNUTS leads to activation of Rb-phosphatase and caspase-mediated apoptosis
17318220 Findings suggest that PNUTS may play an important role in controlling cell death in response to cellular stresses such as hypoxia through the post-translational modification of p53 and MDM2.
15907195 results illustrate an involvement of the PNUTS:PP1 holoenzyme in chromosome decondensation in vitro and argue that PNUTS functions as a PP1-targeting subunit in this process
15894402 PNUTS, encoded by CAT 53 on 6p21.3, may have a role in the progression of AD.
12574161 PNUTS has a role in protein kinase A-regulated targeting of PP1 to specific RNA-associated complexes in the nucleus

AA Sequence

MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVG      1 - 70
GYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQLSKSSEDEELRKLASVLVSDW     71 - 140
MAVIRSQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKPKSLRTTAPSHAKFRS    141 - 210
TGLELETPSLVPVKKNASTVVVSDKYNLKPIPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKI    211 - 280
IPPQPMEGLGFLDALNSAPVPGIKIKKKKKVLSPTAAKPSPFEGKTSTEPSTAKPSSPEPAPPSEAMDAD    281 - 350
RPGTPVPPVEVPELMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETER    351 - 420
VNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVTPGSNSQERYIQAERE    421 - 490
KGILQELFLNKESPHEPDPEPYEPIPPKLIPLDEECSMDETPYVETLEPGGSGGSPDGAGGSKLPPVLAN    491 - 560
LMGSMGAGKGPQGPGGGGINVQEILTSIMGSPNSHPSEELLKQPDYSDKIKQMLVPHGLLGPGPIANGFP    561 - 630
PGGPGGPKGMQHFPPGPGGPMPGPHGGPGGPVGPRLLGPPPPPRGGDPFWDGPGDPMRGGPMRGGPGPGP    631 - 700
GPYHRGRGGRGGNEPPPPPPPFRGARGGRSGGGPPNGRGGPGGGMVGGGGHRPHEGPGGGMGNSSGHRPH    701 - 770
EGPGGGMGSGHRPHEGPGGSMGGGGGHRPHEGPGGGISGGSGHRPHEGPGGGMGAGGGHRPHEGPGGSMG    771 - 840
GSGGHRPHEGPGHGGPHGHRPHDVPGHRGHDHRGPPPHEHRGHDGPGHGGGGHRGHDGGHSHGGDMSNRP    841 - 910
VCRHFMMKGNCRYENNCAFYHPGVNGPPLP                                            911 - 940
//

Text Mined References (37)

PMID Year Title
24591642 2014 Understanding the antagonism of retinoblastoma protein dephosphorylation by PNUTS provides insights into the PP1 regulatory code.
24462707 2014 microRNA-383 impairs phosphorylation of H2AX by targeting PNUTS and inducing cell cycle arrest in testicular embryonal carcinoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23117887 2013 PNUTS functions as a proto-oncogene by sequestering PTEN.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20890310 2010 The protein phosphatase 1 regulator PNUTS is a new component of the DNA damage response.
20516061 2010 Identification and characterization of a novel human PP1 phosphatase complex.
20372802 2010 PNUTS knockdown potentiates the apoptotic effect of Roscovitine in breast and colon cancer cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19429178 2009 CAT53 and HFE alleles in Alzheimer's disease: a putative protective role of the C282Y HFE mutation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19293638 2009 Langerhans cell protein 1 (LCP1) binds to PNUTS in the nucleus: implications for this complex in transcriptional regulation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18360108 2008 Reduced expression of PNUTS leads to activation of Rb-phosphatase and caspase-mediated apoptosis.
17318220 2007 Protein phosphatase 1 nuclear targeting subunit is a hypoxia inducible gene: its role in post-translational modification of p53 and MDM2.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15907195 2005 PNUTS enhances in vitro chromosome decondensation in a PP1-dependent manner.
15894402 2005 CAT 53: a protein phosphatase 1 nuclear targeting subunit encoded in the MHC Class I region strongly expressed in regions of the brain involved in memory, learning, and Alzheimer's disease.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12914669 2003 Inducible expression of catalytically active type 1 serine/threonine protein phosphatase in a human carcinoma cell line.
12574161 2003 PNUTS, a protein phosphatase 1 (PP1) nuclear targeting subunit. Characterization of its PP1- and RNA-binding domains and regulation by phosphorylation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9784381 1998 Cloning of a new gene (FB19) within HLA class I region.
9461602 1998 Isolation and characterization of PNUTS, a putative protein phosphatase 1 nuclear targeting subunit.
9450550 1997 Purification and characterisation of p99, a nuclear modulator of protein phosphatase 1 activity.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8838313 1996 Hereditary hemochromatosis: generation of a transcription map within a refined and extended map of the HLA class I region.