Property Summary

NCBI Gene PubMed Count 16
PubMed Score 33.25
PubTator Score 17.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.200 3.7e-08
osteosarcoma -1.148 5.7e-04
intraductal papillary-mucinous neoplasm ... 1.400 1.0e-03
lung cancer 1.300 7.0e-04
diabetes mellitus -1.100 4.9e-03
lung carcinoma 1.400 1.3e-30
ovarian cancer 1.600 2.8e-08

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
2130 screening 1683 / 0 / 313418 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of Protein Phosphatase Methylesterase 1 (PME-1).
2171 screening 1068 / 0 / 446 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of Protein Phosphatase Methylesterase 1 (PME-1).
2291 screening 73 / 0 / 15927 Fluorescence polarization-based Maybridge primary biochemical high throughput screening assay to identify inhibitors of Protein Phosphatase Methylesterase 1 (PME-1).
2363 screening 2 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of the protein methylesterase PME-1: Inhibition of PME-1-mediated demethylation of PP2a
2368 screening 2 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of the protein methylesterase PME-1: Gel-based Activity-Based Protein Profiling (ABPP) Gel Filtration Assay
2369 screening 5 / 0 / 18 Late stage results from the probe development effort to identify inhibitors of the protein methylesterase PME-1: Gel-based Activity-Based Protein Profiling (ABPP) Inhibition
2371 confirmatory 0 / 0 / 6 Late stage results from the probe development effort to identify inhibitors of the protein methylesterase PME-1: Gel-based Activity-Based Protein Profiling (ABPP) IC50: Purified enzyme
463090 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Phosphatase Methylesterase 1 (PME-1): LC-MS/MS assay to assess binding of compounds to active site
463124 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of protein phosphatase methylesterase 1 (PME-1): Gel-based Activity-Based Protein Profiling (ABPP) IC50 Set 2
463130 confirmatory 4 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of protein phosphatase methylesterase 1 (PME-1): Gel-based Activity-Based Protein Profiling (ABPP) IC50 Set 1
More...

Gene RIF (8)

PMID Text
25839665 LCMT1-PME-1 methylation equilibrium is critical for regulating mitotic spindle size and thereby proper cell division
24841198 this study suggests that the tightly linked regulatory loop comprised of the SIK2-PP2A and CaMKI and PME-1 networks may function in fine-tuning cell proliferation and stress response.
24253382 PPME1 could be an attractive therapeutic target for a subset of gastric cancer and lung cancer.
22732552 GSK-3beta can inhibit PP2A by increasing the inhibitory L309-demethylation involving upregulation of PME-1 and inhibition of PPMT1
22443683 Data indicate that PP2A holoenzyme biogenesis and activity are controlled by five PP2A modulators, consisting of alpha4, PTPA, LCMT1, PME-1 and TIPRL1, which serve to prevent promiscuous phosphatase activity until the holoenzyme is completely assembled.
21398589 Academic cross-fertilization by public screening yields a remarkable class of protein phosphatase methylesterase-1 inhibitors.
19293187 Observations identify PME-1 expression as one mechanism by which ERK pathway activity is maintained in cancer cells and suggest an important functional role for PME-1 in the disease progression of human astrocytic gliomas.
17803990 We propose that stabilization of this inactive, nuclear PP2A pool is a major in vivo function of PME-1.

AA Sequence

MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVY      1 - 70
KSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVE     71 - 140
AMYGDLPPPIMLIGHSMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLEN    141 - 210
AIEWSVKSGQIRNLESARVSMVGQVKQCEGITSPEGSKSIVEGIIEEEEEDEEGSESISKRKKEDDMETK    211 - 280
KDHPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHA    281 - 350
VHEDAPDKVAEAVATFLIRHRFAEPIGGFQCVFPGC                                      351 - 386
//

Text Mined References (27)

PMID Year Title
25839665 2015 A LCMT1-PME-1 methylation equilibrium controls mitotic spindle size.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24841198 2014 Interaction between salt-inducible kinase 2 and protein phosphatase 2A regulates the activity of calcium/calmodulin-dependent protein kinase I and protein phosphatase methylesterase-1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24253382 2014 Genetic amplification of PPME1 in gastric and lung cancer and its potential as a novel therapeutic target.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22732552 2012 Glycogen synthase kinase-3? regulates leucine-309 demethylation of protein phosphatase-2A via PPMT1 and PME-1.
22443683 2013 The biogenesis of active protein phosphatase 2A holoenzymes: a tightly regulated process creating phosphatase specificity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21398589 2011 Academic cross-fertilization by public screening yields a remarkable class of protein phosphatase methylesterase-1 inhibitors.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19293187 2009 PME-1 protects extracellular signal-regulated kinase pathway activity from protein phosphatase 2A-mediated inactivation in human malignant glioma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18394995 2008 Structural mechanism of demethylation and inactivation of protein phosphatase 2A.
17803990 2008 Spatial control of protein phosphatase 2A (de)methylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10318862 1999 A protein phosphatase methylesterase (PME-1) is one of several novel proteins stably associating with two inactive mutants of protein phosphatase 2A.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.