Property Summary

Ligand Count 3
NCBI Gene PubMed Count 18
PubMed Score 33.12
PubTator Score 17.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
diabetes mellitus -1.100 4.9e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.0e-03
lung cancer 1.300 7.0e-04
lung carcinoma 1.400 1.3e-30
malignant mesothelioma 2.000 5.6e-08
osteosarcoma -1.148 5.7e-04
ovarian cancer 1.600 2.8e-08

Gene RIF (10)

AA Sequence

MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVY      1 - 70
KSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVE     71 - 140
AMYGDLPPPIMLIGHSMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLEN    141 - 210
AIEWSVKSGQIRNLESARVSMVGQVKQCEGITSPEGSKSIVEGIIEEEEEDEEGSESISKRKKEDDMETK    211 - 280
KDHPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHA    281 - 350
VHEDAPDKVAEAVATFLIRHRFAEPIGGFQCVFPGC                                      351 - 386
//

Text Mined References (29)

PMID Year Title