Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.57
PubTator Score 8.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
astrocytic glioma -2.800 2.7e-03
posterior fossa group A ependymoma -3.300 1.4e-16
oligodendroglioma -2.000 5.6e-16
esophageal adenocarcinoma 1.100 1.8e-02
glioblastoma -3.200 1.0e-07
osteosarcoma -1.760 2.8e-02
group 4 medulloblastoma -2.800 1.3e-06
cystic fibrosis -2.428 3.9e-05
atypical teratoid / rhabdoid tumor -2.700 4.0e-04
medulloblastoma, large-cell -2.300 2.9e-03
primitive neuroectodermal tumor -2.700 5.3e-04
intraductal papillary-mucinous carcinoma... 1.200 3.0e-03
intraductal papillary-mucinous neoplasm ... 2.100 3.5e-04
lung cancer 2.200 2.2e-04
colon cancer 2.200 5.4e-06
active Crohn's disease 1.635 4.3e-03
active ulcerative colitis 1.145 5.8e-03
interstitial cystitis -1.900 3.7e-04
pediatric high grade glioma -3.000 2.1e-09
pilocytic astrocytoma -2.600 1.7e-09
subependymal giant cell astrocytoma -2.179 2.1e-02
Endometriosis -1.166 4.4e-02
breast carcinoma 1.200 1.1e-14
invasive ductal carcinoma 1.700 3.3e-04

Synonym

Accession Q9ULR3 B1Q2A9 B2RXG4 Q6PI86
Symbols URCC2
ARHCL1
NERPP-2C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
24732009 PPM1H acts as a gatekeeper to prevent excessive BMP signaling through dephosphorylation and subsequent nuclear exclusion of P-Smad1/5/8 proteins.
22586611 Knockdown of the serine/threonine phosphatase PPM1H confers trastuzumab resistance via reduction in protein levels of the tumor suppressor p27.
20732627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20659327 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18059182 PPM1H, overexpressed in colon adenocarcinoma, is associated with CSE1L protein.

AA Sequence

MLTRVKSAVANFMGGIMAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKE      1 - 70
TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKENSESE     71 - 140
GVSCHYWSLFDGHAGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEEPENTPANSRTLTRAA    141 - 210
SLRGGVGAPGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSSYNISGGCTALIVICLLGK    211 - 280
LYVANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELGKKMLY    281 - 350
RDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPEVRIYD    351 - 420
LSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDLVMRARGVLKDRGWRIS    421 - 490
NDRLGSGDDISVYVIPLIHGNKLS                                                  491 - 514
//

Text Mined References (20)

PMID Year Title
24732009 2014 Specific control of BMP signaling and mesenchymal differentiation by cytoplasmic phosphatase PPM1H.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22586611 2011 PPM1H is a p27 phosphatase implicated in trastuzumab resistance.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20732627 2010 Case-control genome-wide association study of attention-deficit/hyperactivity disorder.
20659327 2010 Trait-stratified genome-wide association study identifies novel and diverse genetic associations with serologic and cytokine phenotypes in systemic lupus erythematosus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18059182 2008 Protein phosphatase 1H, overexpressed in colon adenocarcinoma, is associated with CSE1L.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
9770338 1998 A novel phosphatase regulating neurite extension on CNS inhibitors.