Property Summary

NCBI Gene PubMed Count 39
PubMed Score 258.91
PubTator Score 40.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.800 5.9e-04
esophageal adenocarcinoma -3.100 1.8e-02
oligodendroglioma -1.300 4.4e-13
glioblastoma -1.200 2.0e-02
medulloblastoma, large-cell -1.400 2.5e-02
primitive neuroectodermal tumor -2.000 7.7e-04
acute quadriplegic myopathy 1.060 5.5e-04
lung cancer -3.500 2.7e-02
breast carcinoma -1.400 2.6e-06
interstitial cystitis -2.400 1.0e-04
pilocytic astrocytoma -1.500 2.8e-03
sonic hedgehog group medulloblastoma -1.100 2.8e-02
invasive ductal carcinoma -2.700 6.5e-04
nasopharyngeal carcinoma -2.200 9.0e-06
spina bifida -1.806 4.5e-02
Pick disease -1.200 2.8e-02
Breast cancer -1.400 5.4e-08
ductal carcinoma in situ -2.100 1.9e-04
ovarian cancer -1.700 6.8e-07

 GO Process (1)

 MGI Phenotype (1)

Gene RIF (19)

PMID Text
25637025 Human gamma-delta T cells are activated by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin.
25520130 Low serum periplakin is associated with urothelial carcinoma.
24942859 Loss of periplakin expression is associated with pathological stage and cancer-specific survival in patients with urothelial carcinoma of the urinary bladder.
22841549 Annexin A9 and periplakin co-localise in the epidermis and annexin A9 is up-regulated in differentiating keratinocytes, but the epidermal annexin A9 expression does not require periplakin.
21951621 involved in cellular movement and attachment in pharyngeal squamous cancer cells
20468064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19211270 Sciellin, SPRR3, and periplakin transcripts were all upregulated (4.67-, 4.95-, 2.77-fold, respectively) by prolonged exposure to cyclic strain (24-72 h), but not at earlier time points.
18820940 autoantibodies are detected in patients with paraneoplastic pemphigus
17662978 A novel functional co-localisation is identified between two plakin cytolinker proteins.
16400690 Downregulation of periplakin is associated with esophageal squamous cell carcinoma
15654952 caspase 6 cleaves periplakin at an unconventional recognition site, amino acid sequence TVAD
15590649 Periplakin interferes with G protein activation by the melanin-concentrating hormone receptor-1 by binding to the proximal segment of the receptor C-terminal tail
15500642 the involvement of desmoplakin (DP), plectin, and periplakin in the destruction of epithelial cell integrity ensures the efficient elimination of cytoskeleton, but also provides specificity for selectively targeting individual adhesion molecules
15229321 periplakin (PPL) as a selective interacting protein for the intracellular tail of FcgammaRI but no other activatory FcRs
15033990 envoplakin and periplakin bind to the plasma membrane upon elevation of intracellular [Ca(2+)] in differentiating keratinocytes, where they serve as a scaffold for cornified cell envelope assembly
12810704 interactions between helix VIII of the human mu-opioid receptors and the C terminus of periplakin disrupt G protein activation
12366696 in spite of its high homology and structural similarity with envoplakin, periplakin is functionally closer to the plakin proteins plectin and desmoplakin, and may function tissue-wide as a scaffolding protein in intermediate filament assembly
12244133 This protein binds to protein kinase B.

AA Sequence

MNSLFRKRNKGKYSPTVQTRSISNKELSELIEQLQKNADQVEKNIVDTEAKMQSDLARLQEGRQPEHRDV      1 - 70
TLQKVLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYRLAVKEVDPQVNWAA     71 - 140
LVEEKLDKLNNQSFGTDLPLVDHQVEEHNIFHNEVKAIGPHLAKDGDKEQNSELRAKYQKLLAASQARQQ    141 - 210
HLSSLQDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPSRRRQYENFINRNLEAKEERINKLHSEGDQL    211 - 280
LAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPD    281 - 350
FKDRYQIELLLRELDDQEKVLDKYEDVVQGLQKRGQQVVPLKYRRETPLKPIPVEALCDFEGEQGLISRG    351 - 420
YSYTLQKNNGESWELMDSAGNKLIAPAVCFVIPPTDPEALALADSLGSQYRSVRQKAAGSKRTLQQRYEV    421 - 490
LKTENPGDASDLQGRQLLAGLDKVASDLDRQEKAITGILRPPLEQGRAVQDSAERAKDLKNITNELLRIE    491 - 560
PEKTRSTAEGEAFIQALPGSGTTPLLRTRVEDTNRKYEHLLQLLDLAQEKVDVANRLEKSLQQSWELLAT    561 - 630
HENHLNQDDTVPESSRVLDSKGQELAAMACELQAQKSLLGEVEQNLQAAKQCSSTLASRFQEHCPDLERQ    631 - 700
EAEVHKLGQRFNNLRQQVERRAQSLQSAKAAYEHFHRGHDHVLQFLVSIPSYEPQETDSLSQMETKLKNQ    701 - 770
KNLLDEIASREQEVQKICANSQQYQQAVKDYELEAEKLRSLLDLENGRRSHVSKRARLQSPATKVKEEEA    771 - 840
ALAAKFTEVYAINRQRLQNLEFALNLLRQQPEVEVTHETLQRNRPDSGVEEAWKIRKELDEETERRRQLE    841 - 910
NEVKSTQEEIWTLRNQGPQESVVRKEVLKKVPDPVLEESFQQLQRTLAEEQHKNQLLQEELEALQLQLRA    911 - 980
LEQETRDGGQEYVVKEVLRIEPDRAQADEVLQLREELEALRRQKGAREAEVLLLQQRVAALAEEKSRAQE    981 - 1050
KVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSFLQDKLKRLEKERAMAEGKITVKEVLKV   1051 - 1120
EKDAATEREVSDLTRQYEDEAAKARASQREKTELLRKIWALEEENAKVVVQEKVREIVRPDPKAESEVAN   1121 - 1190
LRLELVEQERKYRGAEEQLRSYQSELEALRRRGPQVEVKEVTKEVIKYKTDPEMEKELQRLREEIVDKTR   1191 - 1260
LIERCDLEIYQLKKEIQALKDTKPQVQTKEVVQEILQFQEDPQTKEEVASLRAKLSEEQKKQVDLERERA   1261 - 1330
SQEEQIARKEEELSRVKERVVQQEVVRYEEEPGLRAEASAFAESIDVELRQIDKLRAELRRLQRRRTELE   1331 - 1400
RQLEELERERQARREAEREVQRLQQRLAALEQEEAEAREKVTHTQKVVLQQDPQQAREHALLRLQLEEEQ   1401 - 1470
HRRQLLEGELETLRRKLAALEKAEVKEKVVLSESVQVEKGDTEQEIQRLKSSLEEESRSKRELDVEVSRL   1471 - 1540
EARLSELEFHNSKSSKELDFLREENHKLQLERQNLQLETRRLQSEINMAATETRDLRNMTVADSGTNHDS   1541 - 1610
RLWSLERELDDLKRLSKDKDLEIDELQKRLGSVAVKREQRENHLRRSIVVIHPDTGRELSPEEAHRAGLI   1611 - 1680
DWNMFVKLRSQECDWEEISVKGPNGESSVIHDRKSGKKFSIEEALQSGRLTPAQYDRYVNKDMSIQELAV   1681 - 1750
LVSGQK                                                                   1751 - 1756
//

Text Mined References (45)

PMID Year Title
25637025 2015 Activation of human ?? T cells by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin.
25520130 2014 Serum periplakin as a potential biomarker for urothelial carcinoma of the urinary bladder.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24942859 2014 Loss of periplakin expression is associated with pathological stage and cancer-specific survival in patients with urothelial carcinoma of the urinary bladder.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22841549 2012 Annexin A9 is a periplakin interacting partner in membrane-targeted cytoskeletal linker protein complexes.
22637743 2012 Genome-wide gene-environment interaction analysis for asbestos exposure in lung cancer susceptibility.
21951621 2011 Adhesion molecule periplakin is involved in cellular movement and attachment in pharyngeal squamous cancer cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19211270 Biomechanical stress induces novel arterial intima-enriched genes: implications for vascular adaptation to stress.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18820940 2009 Detection of anti-envoplakin and anti-periplakin autoantibodies by ELISA in patients with paraneoplastic pemphigus.
18624398 2008 Protein interaction data set highlighted with human Ras-MAPK/PI3K signaling pathways.
17662978 2007 Cytolinker cross-talk: periplakin N-terminus interacts with plectin to regulate keratin organisation and epithelial migration.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16400690 2006 Proteomic analysis of primary esophageal squamous cell carcinoma reveals downregulation of a cell adhesion protein, periplakin.
15654952 2005 Breaking the connection: caspase 6 disconnects intermediate filament-binding domain of periplakin from its actin-binding N-terminal region.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15590649 2005 Periplakin interferes with G protein activation by the melanin-concentrating hormone receptor-1 by binding to the proximal segment of the receptor C-terminal tail.
15500642 2004 Plakin proteins are coordinately cleaved during apoptosis but preferentially through the action of different caspases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15229321 2004 Direct interaction between FcgammaRI (CD64) and periplakin controls receptor endocytosis and ligand binding capacity.
15033990 2004 Co-assembly of envoplakin and periplakin into oligomers and Ca(2+)-dependent vesicle binding: implications for cornified cell envelope formation in stratified squamous epithelia.
12810704 2003 Selective interactions between helix VIII of the human mu-opioid receptors and the C terminus of periplakin disrupt G protein activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432088 2002 Interaction of periplakin and envoplakin with intermediate filaments.
12366696 2002 Unique role for the periplakin tail in intermediate filament association: specific binding to keratin 8 and vimentin.
12244133 2002 Binding of protein kinase B to the plakin family member periplakin.
11854008 2002 Plakins: a family of versatile cytolinker proteins.
11062259 2000 Subcellular distribution of envoplakin and periplakin: insights into their role as precursors of the epidermal cornified envelope.
10379702 1999 Autoimmunity against desmosomal cadherins in pemphigus.
10051401 1999 Human periplakin: genomic organization in a clonally unstable region of chromosome 16p with an abundance of repetitive sequence elements.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9570964 1998 The periplakin gene maps to 16p13.3 in human and 16A-B1 in mouse.
9521878 1998 cDNA cloning, mRNA expression, and chromosomal mapping of human and mouse periplakin genes.
9412476 1997 Periplakin, a novel component of cornified envelopes and desmosomes that belongs to the plakin family and forms complexes with envoplakin.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.