Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.21
PubTator Score 27.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 1.1e-07
Rheumatoid Arthritis 1170 9.0e-03

Expression

  Differential Expression (2)

Disease log2 FC p
Rheumatoid Arthritis -1.300 9.0e-03
ovarian cancer -2.100 1.1e-07

Gene RIF (6)

PMID Text
26977013 CYPJ structurally resembles CYPA. It is sensitive to inhibition by CsA and plays a role in regulating cell growth, proliferation, and apoptosis.
26020957 Suppression of CYPJ could repress the growth of HCC, which makes CYPJ a potential target for the development of new strategies to treat this malignancy.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18474220 Human peptidyl-prolyl isomerase-like 3 (Ppil3) is one of the Apoptin-associated proteins.
16510998 Human cyclophilin J, a new member of the cyclophilin family, has been expressed and crystallized.
15989758 The novel full-length gene of human PPIL3 may be correlated with the formation of human glioma.

AA Sequence

MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKK      1 - 70
FEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKT     71 - 140
YRPLNDVHIKDITIHANPFAQ                                                     141 - 161
//

Text Mined References (21)

PMID Year Title
26977013 2016 Biochemical Features of Recombinant Human Cyclophilin J.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26020957 2015 Cyclophilin J is a novel peptidyl-prolyl isomerase and target for repressing the growth of hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18474220 2008 Interaction with Ppil3 leads to the cytoplasmic localization of Apoptin in tumor cells.
16510998 2005 Crystallization and preliminary X-ray crystallographic studies of human cyclophilin J.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15989758 2005 cDNA microarray in isolation of novel differentially expressed genes related to human glioma and clone of a novel full-length gene.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15735342 2005 Structure of recombinant human cyclophilin J, a novel member of the cyclophilin family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11435694 2001 Molecular cloning and characterization of a novel peptidylprolyl isomerase (cyclophilin)-like gene (PPIL3) from human fetal brain.