Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.27
PubTator Score 27.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.1e-07
Rheumatoid arthritis 1191 9.0e-03

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -2.100 1.1e-07
Rheumatoid arthritis -1.300 9.0e-03

Protein-protein Interaction (3)

Gene RIF (7)

AA Sequence

MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKK      1 - 70
FEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKT     71 - 140
YRPLNDVHIKDITIHANPFAQ                                                     141 - 161
//

Text Mined References (22)

PMID Year Title