Property Summary

Ligand Count 1
NCBI Gene PubMed Count 22
PubMed Score 448.14
PubTator Score 117.12

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (15)

Disease log2 FC p
Breast cancer 1.200 6.2e-04
breast carcinoma 1.300 5.1e-12
Down syndrome 1.100 3.3e-03
ependymoma 1.400 1.3e-04
lung adenocarcinoma 1.098 2.5e-04
lung cancer 1.400 4.7e-04
non-small cell lung cancer 1.027 4.1e-10
oligodendroglioma 1.300 3.4e-02
osteosarcoma -1.492 1.4e-02
ovarian cancer 1.500 5.2e-04
pancreatic cancer -1.100 9.8e-03
pancreatic ductal adenocarcinoma liver m... -1.498 4.7e-03
psoriasis 1.700 3.2e-08
spina bifida -1.492 3.8e-02
tuberculosis -2.000 7.0e-04

PDB (40)

Gene RIF (7)

AA Sequence

MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADV      1 - 70
VPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVL     71 - 140
SMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS       141 - 207
//

Text Mined References (32)

PMID Year Title