Property Summary

NCBI Gene PubMed Count 21
PubMed Score 410.65
PubTator Score 117.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
oligodendroglioma 1.300 3.4e-02
psoriasis 2.400 2.3e-07
osteosarcoma -1.492 1.4e-02
posterior fossa group A ependymoma 2.000 8.8e-09
tuberculosis -2.400 1.7e-04
pancreatic ductal adenocarcinoma liver m... -1.498 4.7e-03
non-small cell lung cancer 1.597 5.1e-12
lung cancer 1.400 4.7e-04
lung adenocarcinoma 1.098 2.5e-04
breast carcinoma 1.300 5.1e-12
spina bifida -1.492 3.8e-02
ovarian cancer 1.500 5.2e-04
Breast cancer 1.200 6.2e-04
Down syndrome 1.100 3.3e-03
pancreatic cancer -1.100 9.8e-03

Gene RIF (7)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase F protein (PPIF, cyclophilin F) is identified by yeast two-hybrid screen
20877624 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18614807 There was increased [Ca(2+)](c), [Ca(2+)](m), mCICR, MPTP opening, and expression of cyclophilin D and decreased DeltaPsim in POAG TM cells compared with control cells.
16385451 Observational study of gene-disease association. (HuGE Navigator)
12077116 Cyclophilin D protects cell from cell death.

AA Sequence

MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADV      1 - 70
VPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVL     71 - 140
SMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS       141 - 207
//

Text Mined References (31)

PMID Year Title
26976564 2016 Mitochondrial calcium uniporter regulator 1 (MCUR1) regulates the calcium threshold for the mitochondrial permeability transition.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
22726440 2012 p53 opens the mitochondrial permeability transition pore to trigger necrosis.
21930693 2011 Cysteine 203 of cyclophilin D is critical for cyclophilin D activation of the mitochondrial permeability transition pore.
21904027 2011 In-plate protein crystallization, in situ ligand soaking and X-ray diffraction.
21269460 2011 Initial characterization of the human central proteome.
20950273 2011 Complement 1q-binding protein inhibits the mitochondrial permeability transition pore and protects against oxidative stress-induced death.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19228691 2009 Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect.
18614807 2008 Mitochondrial defects and dysfunction in calcium regulation in glaucomatous trabecular meshwork cells.
18076075 2008 Crystal structure of human cyclophilin D in complex with its inhibitor, cyclosporin A at 0.96-A resolution.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15858260 2005 Crystal engineering yields crystals of cyclophilin D diffracting to 1.7 A resolution.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077116 2002 Mitochondrial targeted cyclophilin D protects cells from cell death by peptidyl prolyl isomerization.
11790298 2002 Directed proteomic analysis of the human nucleolus.
10903836 2000 Construction of a high-resolution physical map of the chromosome 10q22-q23 dilated cardiomyopathy locus and analysis of candidate genes.
10647893 1999 Genomic characterization of the human peptidyl-prolyl-cis-trans-isomerase, mitochondrial precursor gene: assessment of its role in familial dilated cardiomyopathy.
10406942 1999 Import and processing of heart mitochondrial cyclophilin D.
9874241 1998 Cyclophilin-D binds strongly to complexes of the voltage-dependent anion channel and the adenine nucleotide translocase to form the permeability transition pore.
1744118 1991 The cyclophilin multigene family of peptidyl-prolyl isomerases. Characterization of three separate human isoforms.