Property Summary

NCBI Gene PubMed Count 66
PubMed Score 420.86
PubTator Score 155.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.500 3.5e-03
posterior fossa group A ependymoma -1.900 7.8e-12
oligodendroglioma -1.200 1.5e-02
osteosarcoma 1.250 1.5e-05
group 3 medulloblastoma -2.200 1.1e-04
atypical teratoid / rhabdoid tumor -1.700 1.3e-04
glioblastoma -1.300 6.8e-04
medulloblastoma, large-cell -1.300 1.2e-02
primitive neuroectodermal tumor -2.200 3.0e-04
tuberculosis 2.000 3.1e-07
intraductal papillary-mucinous neoplasm ... 1.900 7.3e-03
interstitial cystitis -1.100 3.7e-04
pediatric high grade glioma -1.100 1.9e-03
ulcerative colitis -1.700 2.1e-05
pituitary cancer 3.000 5.0e-09
psoriasis 1.200 6.6e-86

Gene RIF (53)

PMID Text
26427438 Data suggest that PGC-1alpha and PGC-1beta could play a role in regulating retina cell survival, and may be therapeutic targets to prevent retinal degeneration.
26351140 PGC-1(beta) and estrogen-related receptor alpha are aberrantly expressed in human colon cell lines and tumors.
25494292 RUNX3 is related to both the severity of AS and the function of daily life. PPARGC1B is related to the function of daily life.
25367151 Data show that PGC-1beta protein mediated the expression of proinflammatory cytokines and apoptosis through extracellular signal-regulated kinase (ERK), p38 and NF-kappaB in rheumatoid arthritis fibroblast-like synoviocytes.
24359475 Variation in the PPARGC1B gene may be associated with type 2 diabetes among middle-aged Chinese men and women.
23877360 cell apoptosis is orchestrated by the balance between several signaling pathways, and PGC-1beta takes part in these events in breast cancer cells mediated by the mTOR signaling pathway.
23866026 PPARgamma and PPARGC1B polymorphisms modulate the association between phthalate exposure and BC risk
23680128 PGC-1b, a coactivator of both LXR-alpha and SREBP-1, was markedly down-regulated by OEPAs compared with EPA.
23637848 PPARGC1B is associated with the susceptibility to ankylosing spondylitis in the Chinese Han population.
23264620 Peroxisome proliferator-activated receptor gamma coactivator 1beta (PGC-1beta) protein attenuates vascular lesion formation by inhibition of chromatin loading of minichromosome maintenance complex in smooth muscle cells
23201126 Inhibition of PGC-1a and PGC-1b blocks the alpha-MSH-mediated induction of MITF and melanogenic genes.
22939990 Absence of PGC-1 proteins accelerated the transition to heart failure following pressure overload.
22777349 PGC-1beta mediates adaptive chemoresistance to cisplatin associated with mitochondrial DNA mutations in non-small-cell lung cancer cells.
22533417 Acetyl-L-carnitine activates the peroxisome proliferator-activated receptor-gamma coactivators PGC-1alpha/PGC-1beta-dependent signaling cascade of mitochondrial biogenesis and decreases the oxidized peroxiredoxins content in old rat liver
21862727 Exercise can activate an upstream promoter in humans and support AMPK as a major regulator of transcripts from the canonical PGC-1alpha promoter and the involvement of beta-adrenergic stimulation in combination with AMPK in the regulation of PGC-1alpha-b.
21692888 Polymorphisms of -427C>T on the promoter and those of +102525G>A on exon 5 of the PPARGC1B gene may affect the development of AHR through the modulation of PPARGC1B gene products.
21458501 Data show that mitogen-activated protein kinase kinases direct mitochondrial biogenesis by selectively inducing PGC-1beta expression.
21364124 PGC-1beta is a potent regulator of angiogenesis, thus providing a novel link between the regulations of oxidative metabolism and vascular density.
21269472 DNA polymorphisms of PPARGC1B, coding a bona fide ER co-activator, are associated with ER-positive breast cancer risk.
21054343 physiological role of PGC-1beta: investigation of mitochondrial homeostasis regulatory pathway involving PGC-1beta and PI3K; investigation of regulation of PGC-1beta gene expression
20889127 miR-378( *) inhibits the expression of two PGC-1beta partners, ERRgamma and GABPA, leading to a reduction in TCA cycle gene expression and oxygen consumption as well as an increase in lactate production and in cell proliferation
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20561910 Taken together, these results confirm the direct interaction of NRF-1 and ERR alpha with PGC-1 beta, and their participation in mitochondrial biogenesis and respiration.
20477822 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20058823 the PPARGC1B gene Ala203Pro polymorphism is associated with physical performance of athletes.
20058823 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19653005 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19491097 PGC-1beta is a substrate for general control of amino-acid synthesis (GCN5) and is acetylated on at least 10 lysine residues that are distributed along multiple domains of the protein.
19297390 PGC-1alpha and PGC-1beta expression improved mitochondrial respiration in cells from patients with mitochondrial disorders.
19065516 the association of the 482G/A polymorphism of the PGC-1alpha gene with type 2 diabetes and the quantitative and qualitative binding force changes between the PGC-1alpha domain mutant and MEF2C
18974884 A novel role of PGC-1beta in mitochondrial physiology, namely the control of mitochondrial fusion mainly through Mfn2.
18660489 Observational study of gene-disease association. (HuGE Navigator)
17690194 training caused a decrease in PGC-1beta mRNA levels.
17579828 Observational study of gene-disease association. (HuGE Navigator)
17579828 Study suggests that young carriers of a PGC-1beta 203Pro allele have enhanced insulin-stimulated glucose metabolism and may be protected against an age-related decline in PGC-1beta expression in muscle.
17341490 Upregulation of PGC-1alpha and PGC-1beta in the colorectal tumor cells can be part of an adaptation mechanism to help overcome the severe consequences of mtDNA mutations on oxidative phosphorylation.
17018837 Recent studies have elucidated the function of the PGC-1 coactivators in different tissues and have highlighted the implications of PGC-1 dysregulation in diseases such as diabetes, obesity, cardiomyopathy, or neurodegeneration.
16896940 Acute elevation of plasma non-esterified fatty acd levels downregulates PPARGC1A, PPARGC1B and PPARA expression.
16759305 Observational study of gene-disease association. (HuGE Navigator)
16704985 Observational study of gene-disease association. (HuGE Navigator)
16704985 PPARGC1A, PPARGC1B, and EP300 may have roles for familial breast cancer susceptibility
16132959 fatty acids differentially regulated expression of the genes encoding the PGC-1B isoform
15863669 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15863669 Variation of PGC-1beta may contribute to the pathogenesis of obesity, with a widespread Ala203 allele being a risk factor for the development of this common disorder.
12551939 role in activating orphan nuclear constitutive androstane receptor
12181319 role in coactivating the cardiac-enriched nuclear receptors estrogen-related receptor-alpha and -gamma
11854298 The PGC-1-related protein PERC is a selective coactivator of estrogen receptor alpha

AA Sequence

MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSET      1 - 70
EPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAP     71 - 140
EKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQS    141 - 210
RSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVS    211 - 280
QEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD    281 - 350
VLCDVSKPYRLATPVYASLTPRSRPRPPKDSQASPGRPSSVEEVRIAASPKSTGPRPSLRPLRLEVKREV    351 - 420
RRPARLQQQEEEDEEEEEEEEEEEKEEEEEWGRKRPGRGLPWTKLGRKLESSVCPVRRSRRLNPELGPWL    421 - 490
TFADEPLVPSEPQGALPSLCLAPKAYDVERELGSPTDEDSGQDQQLLRGPQIPALESPCESGCGDMDEDP    491 - 560
SCPQLPPRDSPRCLMLALSQSDPTFGKKSFEQTLTVELCGTAGLTPPTTPPYKPTEEDPFKPDIKHSLGK    561 - 630
EIALSLPSPEGLSLKATPGAAHKLPKKHPERSELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLRP    631 - 700
EGVLQRKVLRSWEPSGVHLEDWPQQGAPWAEAQAPGREEDRSCDAGAPPKDSTLLRDHEIRASLTKHFGL    701 - 770
LETALEEEDLASCKSPEYDTVFEDSSSSSGESSFLPEEEEEEGEEEEEDDEEEDSGVSPTCSDHCPYQSP    771 - 840
PSKANRQLCSRSRSSSGSSPCHSWSPATRRNFRCESRGPCSDRTPSIRHARKRREKAIGEGRVVYIQNLS    841 - 910
SDMSSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLR    911 - 980
HFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH                               981 - 1023
//

Text Mined References (70)

PMID Year Title
26427438 2016 The Potential Use of PGC-1? and PGC-1? to Protect the Retina by Stimulating Mitochondrial Repair.
26351140 2015 AMPK Promotes Aberrant PGC1? Expression To Support Human Colon Tumor Cell Survival.
25494292 2015 Analysis of clinical indexes and RUNX3, TBKBP1, PPARGC1B polymorphisms in Chinese Han patients with ankylosing spondylitis.
25367151 2014 Down-regulating peroxisome proliferator-activated receptor-gamma coactivator-1 beta alleviates the proinflammatory effect of rheumatoid arthritis fibroblast-like synoviocytes through inhibiting extracellular signal-regulated kinase, p38 and nuclear factor-kappaB activation.
24359475 2014 Genetic variation in the peroxisome proliferator-activated receptor (PPAR) and peroxisome proliferator-activated receptor gamma co-activator 1 (PGC1) gene families and type 2 diabetes.
23877360 2013 Apoptosis induced by PGC-1? in breast cancer cells is mediated by the mTOR pathway.
23866026 2013 PPAR? and PPARGC1B polymorphisms modify the association between phthalate metabolites and breast cancer risk.
23836911 2013 Peroxisome proliferator-activated receptor ? coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells.
23680128 2013 Oxidized eicosapentaenoic acids more potently reduce LXR?-induced cellular triacylglycerol via suppression of SREBP-1c, PGC-1? and GPA than its intact form.
23637848 2013 Analysis of PPARGC1B, RUNX3 and TBKBP1 polymorphisms in Chinese Han patients with ankylosing spondylitis: a case-control study.
23264620 2013 Peroxisome proliferator-activated receptor ? coactivator 1? (PGC-1?) protein attenuates vascular lesion formation by inhibition of chromatin loading of minichromosome maintenance complex in smooth muscle cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23201126 2013 PGC-1 coactivators regulate MITF and the tanning response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22939990 2012 PGC-1 proteins and heart failure.
22890011 2012 Genome-wide association study indicates variants associated with insulin signaling and inflammation mediate lipoprotein responses to fenofibrate.
22777349 2013 PGC-1? mediates adaptive chemoresistance associated with mitochondrial DNA mutations.
22533417 2012 Acetyl-L-carnitine activates the peroxisome proliferator-activated receptor-? coactivators PGC-1?/PGC-1?-dependent signaling cascade of mitochondrial biogenesis and decreases the oxidized peroxiredoxins content in old rat liver.
21862727 2011 Alternative splice variant PGC-1?-b is strongly induced by exercise in human skeletal muscle.
21692888 2011 Genetic effect of single-nucleotide polymorphisms in the PPARGC1B gene on airway hyperreactivity in asthmatic patients.
21458501 2011 Mitogen-activated protein kinase kinases promote mitochondrial biogenesis in part through inducing peroxisome proliferator-activated receptor ? coactivator-1? expression.
21364124 2011 PGC-1? regulates angiogenesis in skeletal muscle.
21269472 2011 Genetic variation of ESR1 and its co-activator PPARGC1B is synergistic in augmenting the risk of estrogen receptor-positive breast cancer.
21054343 2011 Phosphatidylinositol 3-kinase affects mitochondrial function in part through inducing peroxisome proliferator-activated receptor ? coactivator-1? expression.
20889127 2010 miR-378(?) mediates metabolic shift in breast cancer cells via the PGC-1?/ERR? transcriptional pathway.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20561910 2010 PGC-1 beta-regulated mitochondrial biogenesis and function in myotubes is mediated by NRF-1 and ERR alpha.
20477822 2011 Single-nucleotide polymorphisms within the antioxidant defence system and associations with aggressive prostate cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20058823 2009 [The analysis of PPARGC1B gene polymorphism in athletes].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19653005 2009 The combined impact of metabolic gene polymorphisms on elite endurance athlete status and related phenotypes.
19491097 2009 GCN5-mediated transcriptional control of the metabolic coactivator PGC-1beta through lysine acetylation.
19340012 2009 Genome-wide association study of tanning phenotype in a population of European ancestry.
19297390 2009 PGC-1alpha/beta induced expression partially compensates for respiratory chain defects in cells from patients with mitochondrial disorders.
19065516 2008 [Study of the 482G/A variation in PGC-1alpha gene domain MEF2C as possible mechanism of type 2 diabetes].
18974884 2008 Mitochondrial fusion is increased by the nuclear coactivator PGC-1beta.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
17690194 2007 PGC-1beta is downregulated by training in human skeletal muscle: no effect of training twice every second day vs. once daily on expression of the PGC-1 family.
17579828 2007 Impact of the peroxisome proliferator activated receptor-gamma coactivator-1beta (PGC-1beta) Ala203Pro polymorphism on in vivo metabolism, PGC-1beta expression and fibre type composition in human skeletal muscle.
17341490 2007 PGC-1alpha/beta upregulation is associated with improved oxidative phosphorylation in cells harboring nonsense mtDNA mutations.
17018837 2006 Peroxisome proliferator-activated receptor gamma coactivator 1 coactivators, energy homeostasis, and metabolism.
16896940 2006 Peroxisome proliferator-activated receptor-gamma coactivator-1 and insulin resistance: acute effect of fatty acids.
16759305 2006 Putative association of peroxisome proliferator-activated receptor gamma co-activator 1beta (PPARGC1B) polymorphism with Type 2 diabetes mellitus.
16704985 2006 Associations of genetic variants in the estrogen receptor coactivators PPARGC1A, PPARGC1B and EP300 with familial breast cancer.
16132959 2005 Fatty acid-induced differential regulation of the genes encoding peroxisome proliferator-activated receptor-gamma coactivator-1alpha and -1beta in human skeletal muscle cells that have been differentiated in vitro.
15863669 2005 Evidence of an association between genetic variation of the coactivator PGC-1beta and obesity.
15546003 2004 Multiple environmental and genetic factors influence skeletal muscle PGC-1alpha and PGC-1beta gene expression in twins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12832613 2003 Coordinated reduction of genes of oxidative metabolism in humans with insulin resistance and diabetes: Potential role of PGC1 and NRF1.
12678921 2003 Characterization of the human, mouse and rat PGC1 beta (peroxisome-proliferator-activated receptor-gamma co-activator 1 beta) gene in vitro and in vivo.
12565902 2003 Reduced expression of PGC-1 and insulin-signaling molecules in adipose tissue is associated with insulin resistance.
12551939 2003 Activation of orphan nuclear constitutive androstane receptor requires subnuclear targeting by peroxisome proliferator-activated receptor gamma coactivator-1 alpha. A possible link between xenobiotic response and nutritional state.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470660 2002 PGC-1 and PERC, coactivators of the estrogen receptor-related receptor gamma.
12181319 2002 Peroxisome proliferator-activated receptor coactivator-1alpha (PGC-1alpha) coactivates the cardiac-enriched nuclear receptors estrogen-related receptor-alpha and -gamma. Identification of novel leucine-rich interaction motif within PGC-1alpha.
12107756 2002 A genetic variation in the PGC-1 gene could confer insulin resistance and susceptibility to Type II diabetes.
12032643 2002 No association between the G482S polymorphism of the proliferator-activated receptor-gamma coactivator-1 (PGC-1) gene and Type II diabetes in French Caucasians.
11854298 2002 The PGC-1-related protein PERC is a selective coactivator of estrogen receptor alpha.
11793024 2001 Mutation analysis of peroxisome proliferator-activated receptor-gamma coactivator-1 (PGC-1) and relationships of identified amino acid polymorphisms to Type II diabetes mellitus.
11733490 2002 Peroxisome proliferator-activated receptor gamma coactivator 1beta (PGC-1beta ), a novel PGC-1-related transcription coactivator associated with host cell factor.
10713165 2000 A tissue-specific coactivator of steroid receptors, identified in a functional genetic screen.
10585775 1999 Human peroxisome proliferator activated receptor gamma coactivator 1 (PPARGC1) gene: cDNA sequence, genomic organization, chromosomal localization, and tissue expression.