Property Summary

NCBI Gene PubMed Count 486
PubMed Score 2399.72
PubTator Score 2697.10

Knowledge Summary

Patent (54,945)

TINX Plot

  Disease (4)

Expression

 GO Component (2)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504735 confirmatory 3 / 0 / 3 Late stage assay provider counterscreen for partial agonists of the peroxisome proliferator-activated receptor gamma (PPARg): Luminescence-based cell-based dose response assay for partial agonists of the peroxisome proliferator-activated receptor alpha (PPARA).
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (457)

PMID Text
26775637 cPGI2 activates PPARalpha and PPARgamma, which act separately from IP-R to up-regulate the expression of key genes involved in the function of brite adipocytes.
26722456 PPAR-gamma and PTEN expressions are related to the clinical parameters and prognosis of renal cell carcinoma
26718439 PPAR agonists troglitazone and aleglitazar reverse doxorubicin resistance of human myelogenous leukemia cells.
26673968 No association was found between PPARalpha L162V single nucleotide polymorphisms with obesity and metabolic syndrome in a multi-ethnic population in Kampar, Malaysia.
26671025 There was no statistically significant difference in the distribution of PPARalpha Leu162Val polymorphism between the ischemic stroke patients and controls in the Han ethnic group.
26617775 Describe a renoprotective role of fenofibrate in albumin bound fatty acid associated tubular toxicity, involving the transcriptional activation of PPARalpha and suppression of NF-kB.
26577021 These results suggest that EPA inhibits intestinal beta-carotene absorption by down regulation of SR B1 expression via PPARalpha dependent mechanism and provide an evidence for dietary modulation of intestinal beta-carotene absorption.
26556865 PPARalpha functions as an E3 ubiquitin ligase to induce Bcl2 ubiquitination and degradation, leading to increased cancer cell sensitivity in response to chemotherapy drugs.
26497374 results support an important association between rs1800206 minor allele (V) of PPAR alpha and lower CRP level; the interaction analysis showed a combined effect between rs1800206 and rs135539 on the lower CRP level
26472199 Supplementation with the PPARalpha agonist WY14643 improved the homeostasis and barrier function of filaggrin deficient skin models by normalization of the free fatty acid profile.
26460070 we show that fenofibrate, a PPAR-alpha agonist, increased the expression of miR-301a/miR-454 and SKA2 in human microvascular endothelial cell line (HMEC) cells; the former were responsible for reduced expression of ET-1 and PAI-1
26449539 Our data underscore the major role of PPARalpha in regulation of hepatic lipid and xenobiotic metabolism in human liver and reveal a marked immuno-suppressive/anti-inflammatory effect of PPARalpha in human liver slices
26443578 A change in the heterodimeric partner of Peroxisome Proliferator Activated Receptor-alpha from retinoid X receptor to Silent information regulator 1 is responsible for the impaired fatty acid metabolism and cardiac dysfunction in the failing heart.
26387026 this is the first study to report that 9-oxo-OTA promotes fatty acid metabolism via PPARalpha activation and discuss its potential as a valuable food-derived compound for use in the management of dyslipidemia.
26380295 Both PPARA and PPARGC1A regulate transcription of genes commonly regulated by glycolysis, by the antidiabetic agent metformin and by NOX, suggesting their major interplay in the control of hepatocellular carcinoma progression
26334901 Donor PPARalpha gene polymorphisms influence the susceptibility to metabolic disorders following liver transplantation and may also be associated with a fasten tacrolimus metabolism because of elevated CYP3A4 expression.
26330104 Downregulation of miR-34a may be a therapeutic strategy against nonalcoholic fatty liver disease by regulating its target PPARalpha and SIRT1.
26122096 truncated PPARa splice variant functions as an endogenous inhibitor of proliferative and pro-inflammatory genes in human cells and that its absence in mouse may explain species-specific differences in fibrate-induced hepatocarcinogenesis.
26098621 Evidence that multiple PPARalpha/delta/gamma gene polymorphisms are individually associated with increased low-density lipoprotein-cholesterol, and that interactions, among these alleles result in additional increased risk suggesting that PPAR genes may contribute substantially to the risk of cardiovascular diseases and atherosclerosis.
26093984 Peroxisome proliferator-activated receptors (PPARs) play pivotal roles in maintenance of Chorionic NAD-dependent 15-hydroxy prostaglandin dehydrogenase (PGDH) expression in chorion during human pregnancy.
26070013 these results suggest that fatty acid metabolism promotes survival and proliferation of primary chronic lymphocytic leukemia (CLL) cells and that inhibiting PPARa gene regulation could be a new therapeutic approach to treating CLL.
25986483 A PPARG variant is associated with susceptibility to SSc, consistent with a role of PPAR-gamma in the pathogenesis of SSc.
25979856 Clematichinenoside prevented dyslipidemia-induced atherosclerosis via hepatic PPARalpha/APOA1/APOA2/APOC3 metabolism.
25970251 role of PPAR-alpha in stimulating self-renewal of early erythroid progenitor cells suggests that PPAR-alpha agonists may improve the efficacy of corticosteroids in treating Epo-resistant anaemias
25920026 PPARalpha Leu162Val is unlikely to contribute significantly to a susceptibility to, or affect the progression of ischemic stroke in Uyghur population
25847235 FABP1 and FABP2 have roles in differentially modulating the activation of PPARalpha in a ligand-selective manner
25826986 PPAR alpha genotype was overrepresented in the group of survivors of besieged Leningrad compared to relevant control groups of the persons of the same age who did not suffered hungry disaster.
25825462 We found that women change their diurnal expression profiles of PPARalpha and BMAL1 when switching from the fed to the fasted state, whereas men do not.
25758678 PPARs involved in the pathogenesis of migraine.
25734487 PPARalpha activation by an agonist WY-14643 could potentiate IFN-alpha responses, reverse IFN-alpha refractoriness, and enhance viral eradication in hepatocytes.
25722086 These new data indicate that 4-hydroxynonenal, generated following NADPH oxidase activation, functions as an endogenous activator of PPARalpha and PPARbeta/delta.
25703085 Human liver PPARalpha gene expression negatively correlates with NASH severity, visceral adiposity and insulin resistance and positively with adiponectin.
25691623 Expression of Nrf2 was reduced by knockdown of PPAR-gamma, whereas PPAR-gamma was reduced by knockdown of Nrf2, thereby demonstrating 2-way positive interactions.
25670618 Higher apoptosis in PARP-1 knocked down HeLa cells compared with negative control cells after irradiation.
25575492 cAMP response element-binding protein is regulated at the transcriptional level in the hippocampus by peroxisome proliferator-activated receptor alpha--{REVIEW}
25566967 we showed that Fenofibrate, a PPARalpha agonist, could inhibit U87MG cell proliferation and induce cell cycle arrest via the PPARa/FoxO1/p27kip pathway.
25548431 Ulcerative colitis patients with high gene expression of PPAR-alpha and -gamma have a better response to medical treatment and a mild clinical course of the disease.
25533124 down-regulation of PPARalpha is associated with steatogenesis in CTLN2 patients. These findings provide a novel link between urea cycle disorder, lipid metabolism, and PPARalpha.
25516156 Peroxisome proliferator-activated receptors alpha and gamma are linked with alcohol consumption in mice and withdrawal and dependence in humans
25500634 Changes in gene expression in PBMCs profiles of PPARalpha target genes in obese and non-obese individuals during fasting.
25496486 Abietic acid acts as a PPARalpha/gamma dual activator to inhibit UVB-induced MMP-1 expression and age-related inflammation by suppressing NF-kappaB and the MAPK/AP-1 pathway
25461249 There is an association between PPARA gene polymorphisms and phenprocoumon dose.
25428568 the combination of orthogonal information sources led to investigation of a surprising predicted relationship between a transcription factor and an enzyme, specifically, PPARalpha and the cyclooxygenase enzymes
25389292 PPARA activity increases the expression of miR-199a2 which in turn is responsible for reduced expression of HIF-1a and ET-1.
25379721 In univariate analysis, for PPARrs1801282, patients with a CC genotype had significantly lower recurrence probability (29 +/- 4% SE) compared with patients with a CG genotype (48 +/- 8% SE)
25370040 We found selection signals in PPARA, a gene involved in energy metabolism during prolonged food deficiency
25327562 PPARalpha suppresses liver tumor cell growth by inhibiting cell proliferation and inducing cell apoptosis via direct targeting IkappaBalpha and NF-kappaB signaling pathway.
25291031 Induced levels of PPARalpha may be involved in the Delta(9)-THC up-regulation of FA2H in MDA-MB-231 cells.
25225039 we detected an obvious change of the PPARalpha expression pattern along the crypt-villous axis in the 11th week of intrauterine development
25198533 PPARA intron polymorphism associated with power performance in 30-s anaerobic Wingate Test
25193434 Triclosan was not an activator of PPARa in a human PPARa reporter assay.
25165883 PPARalpha activation directly induced autophagy in primary macrophages in vitro, which protected cells from a lipopolysaccharide-induced proinflammatory response.
25087592 The PPARalpha-L162V polymorphism is not associated with schizophrenia risk in Croatian population, but it impacts clinical expression of the illness and plasma lipid concentrations in female patients.
25052003 This indicates that fibrates can activate CAR and that fibrates-insulin sensitization effect may occur through CAR, while hypolipidemic effect may operate through PPARalpha.
25003192 the secreted cell adhesion protein periostin is markedly upregulated in livers of obese patients, along with reduced expression of PPARalpha
24996283 Our results suggest that PPAR-alpha and PPARGC1A gene variants have a strong effect on aerobic performance of elite level athletes.
24976416 Genetic analysis of PPARA rs135549 might help identify those individuals who are more likely to benefit from reducing the saturated fatty acid content of their diet.
24928010 Activation of PPARA suppresses tumor cell proliferation, delays the cell cycle at G1 phrase.
24880474 PPARA and PPARG polymorphisms should be involved in the regulation of plasma Lp(a) independently and/or in an interactive manner.
24876382 data uncover HILPDA as a novel PPAR target that raises hepatic triglyceride storage via regulation of triglyceride secretion.
24875102 Human FABP1 T94A variant impacts fatty acid metabolism and PPAR-alpha activation in cultured human female hepatocytes.
24829353 Overall, hepatitis C virus infection upregulates both PGC-1alpha isoforms through an endoplasmic reticulum stress-mediated, phosphorylated CREB-dependent pathway, and both PGC-1alpha isoforms promote hepatitis C virus production in turn.
24751833 show that hepatic vanin-1 is under extremely sensitive regulation by PPARalpha and that plasma vanin activity could serve as a readout of changes in PPARalpha activity in human subjects
24713062 PPARalpha and LXRalpha interact with high affinity, resulting in altered protein conformations, the affinity of this interaction and the resulting conformational changes could be altered by endogenous PPARalpha ligands, namely long chain fatty acids.
24675006 Variations in the PPARalpha gene appear to magnify the cardiometabolic benefits of habitual physical activity
24657893 Cardiomyocyte-specific PPAR-alpha overexpression leads to irreversible cardiomyocyte loss in ischemic heart.
24657322 These results first declare that MAPK-PPARalpha/gamma reciprocal signal pathways are involved in Chlamydia pneumoniae, which induces foam cell formation, thus facilitating atherogenesis.
24639097 MicroRNA-518d regulates PPARalpha protein expression in the placentas of females with gestational diabetes mellitus.
24606127 Adiponectin limits fetal growth mediated by activation of placental PPARalpha and ceramide synthesis, which inhibits placental insulin signaling and amino acid transport, resulting in reduced fetal nutrient availability.
24585388 The overexpression of PPAR-alpha as a regulator of fatty acid synthesis is an early change in response to differentiation process.
24467636 The dual PPARalpha/gamma agonist aleglitazar increased migration/proliferation of endothelial progenitor cells from coronary artety disease patients.
24460649 PPAR-alpha and PPAR-gamma polymorphisms and haplotypes may be the genetic risk factors for dyslipidemia.
24444220 Studied the impact of ACE (I/D), PPARGC1A (G/A) and PPARA (G/C) polymorphisms on footballers performance among 199 Lithuanian professional footballers and 167 sedentary, healthy men (controls).
24368768 The results imply that down-regulation of pulmonary epithelial PPARgamma by cigarette smoke promotes inflammatory pathways and diminishes glucocorticoid responsiveness, thereby contributing to COPD pathogenesis, and further suggest that PPARgamma agonists may be useful for COPD treatment.
24315978 Role of PPAR, LXR, and PXR in epidermal homeostasis and inflammation.
24309288 resveratrol protects RPE cells from sodium iodate injury through the activation of PPARalpha and alteration of PPARdelta conformation. PPARalpha and delta modulators might ameliorate stress-induced RPE degeneration in vivo.
24277691 Protective effects of breastfeeding are reflected in higher expression levels of SLC27A2, FASN, PPARalpha and INSR in blood cells.
24232815 The polymorphisms investigated in PPARA (rs1800206), RXRA (rs11381416), and NR1I2 (rs1523130) did not influence the lipid-lowering efficacy and safety of statin and our results show the possible influence of NR1I3 genetic variant on the safety of statin.
24169559 11beta-HSD2 expression can be modulated by PPARalpha and PPARgamma in placental trophoblasts through Sp-1
24140347 Liver contributes to Vanin-1 secretion in serum and PPARalpha is a limiting factor in serum Vnn1 production.
24138287 Search for a novel PPAR-alpha agonist.
24122873 Fenofibrate transactivates MDR3 gene transcription by way of the binding of PPARalpha to three novel and functionally critical response elements in the MDR3 promoter.
24113216 Candidate-gene study shows that polymorphisms in PPARalpha and POR might predispose patients being treated with tacrolimus to the development of NODAT after kidney transplantation.
24068329 This study aimed to investigate the effects of PPARalpha activation, through a specific agonist, on endoplasmic reticulum stress-induced apoptosis in human liver hepatocellular carcinoma (HepG2) cells.
23951092 Data indicate that PPARalpha antagonist, GW6471, induced both apoptosis and cell cycle arrest at G0/G1 in renal cell carcinoma (RCC) cell lines.
23930676 The minor alleles of the PPARA rs4253728 and rs4823613 polymorphisms are associated with a better total and LDL-cholesterol-lowering response to simvastatin, possibly through influence on CYP3A4.
23919842 Our data suggest a gender difference in the associations between APOE, SCARB1, PPARalpha genotypes and lipid levels
23891824 The Leu162Val polymorphism of PPARalpha may be involved in the progression of non-alcoholic fatty liver disease.
23821302 Data suggest that neuroblastoma (NB) cell differentiation might associate with peroxisome proliferator-activated receptor alpha (PPARalpha) and URG4/URGCP gene expression profile after retinoic acid (RA) treatment.
23814018 PPARalpha and fatty acid oxidation have roles in mediating glucocorticoid resistance in chronic lymphocytic leukemia
23811234 PPARs play a role in placental nitric oxide (NO) and lipid homeostasis and can regulate NO production, lipid concentrations and lipoperoxidation in placentas from type 2 diabetic patients.
23797899 species differences in binding specificity and activity of peroxisome proliferator-activated receptor alpha
23736812 DNA from 4 HPV positive and 4 HPV negative fresh frozen primary HNSCC were subject to comprehensive genome-wide methylation profiling.Pathway analysis of 1168 methylated genes showed 8 signal transduction pathways (PPARA) of which 62% are hypermethylated.
23711995 PPARalpha and PPARgamma up-regulate the expression of human MBL2 via the peroxisome proliferator response element.
23707408 The crystal structure of this complex suggests that WY14643 induces activation of PPARalpha in an unusual bipartite mechanism involving conventional direct helix 12 stabilization and an alternative mode that involves a second ligand in the pocket.
23666678 Carriers of the Ala12 allele of the PPARG2 gene had a higher average BMI. [Meta-Analysis]
23657974 the expression of the adipogenic differentiation genes fatty acid binding protein-4, adiponectin, and leptin and the formation of fat droplets were impaired.
23645771 High expression of PPAR gamma is associated with complete necrosis of a giant cell tumor.
23583468 PPARA-V162 allele is associated with high cholesterol levels in nondiabetic coronary heart disease patients.
23567058 Data suggest that PPARA mediates satiety-inducing effects of OEA (oleoylethanolamide), endogenous high-affinity PPARA agonist released during fat digestion in small intestine; PPARA /OEA signaling appears to control satiety response/feeding behavior.
23522297 Alteration of PPARgamma expression by PPARgamma-small interfering ribonucleic acid or activation by its agonist rosiglitazone, a diabetic thiazolidinedione drug, could lead to alternation of BCa cell migration and invasion.
23502212 Results identified the ligand-binding domain in peroxisome proliferator-activated receptors (PPARs) alpha and gamma.
23476056 Transgenic PPAR-alpha is upregulated in the myocardium of mice that are negative for NADPH oxidase.
23372804 Peroxisome proliferator activated receptor-alpha/hypoxia inducible factor-1alpha interplay sustains carbonic anhydrase IX and apoliprotein E expression in breast cancer stem cells.
23329136 Fenofibrate decreases ET-1 expression by PPARalpha-dependent/independent pathways in endothelial cells.
23295386 PPARalpha as a direct transcriptional regulator of hepatic CYP3A4.
23262340 PPAR-alpha, PPAR-delta and PPAR-gamma polymorphisms may contribute to the risk of hypertriglyceridemia independently and/or in an interactive manner.
23208589 Loss of expression of GMPR2 and PPARalpha is associated with breast cancer basal phenotype; indicating that they may play a role in carcinogenesis.
23160450 PPARalpha is a biological mediator of Chronic lymphocytic leukemia.
23158661 Homozygous genotype (CC) of rs4253778 increased the risk of essential hypertension. The A-G-V and C-G-V haplotypes were associated with a statistically significant decreased risk of EH.
23144166 Human pregnancy is associated with changes in expression of PPARalpha in myometrium.
23141142 TNF-alpha might, at least in part, suppress PPAR-alpha expression through activation of IKK/p50/p105/p65 pathway
23076161 The PPARalpha F24 mutation enhances the risk of breast cancer along with APOE epsilon4 genotype in a Taiwanese population.
22989886 Gemfibrozil and fenofibrate, Food and Drug Administration-approved lipid-lowering drugs, up-regulate tripeptidyl-peptidase 1 in brain cells via peroxisome proliferator-activated receptor alpha and may have implications in late infantile Batten disease therapy
22983821 The male carriers of the PPARA gene C allele demonstrated the best results of handgrip strength testing than GG homozygotes.
22944052 There is an interaction between PPARA, PPARD and PPARG SNPs on the incidence of abdominal obesity.
22940187 The changes in PPARgamma and PPARalpha expression are associated with the steatosis and the impairment of antioxidant system in the liver of Wilson's disease patients.
22932900 activation of PPARalpha suppresses hypoxia-induced HIF-1alpha signaling in cancer cells, providing novel insight into the anticancer properties of PPARalpha agonists.
22920733 findings suggest a potential role for PPARA in the susceptibility to SZ.
22685582 Data indicate that the agonists not only possessed the same function as GW409544 did in activating PPAR-alpha and PPAR-gamma, but also had more favorable conformation for binding to the two receptors.
22654113 The synthetic cannabinoid R(+)WIN55,212-2 augments interferon-beta expression via peroxisome proliferator-activated receptor-alpha.
22649490 Medium chain fatty acids are selective peroxisome proliferator activated receptor (PPAR) gamma activators and pan-PPAR partial agonists.
22647601 observations indicate that human T cells exhibit a sex difference in the production of IFNgamma and IL-17A that may be driven by expressions of PPARalpha and PPARgamma
22547144 We conclude that variants in the PPARalpha gene may contribute to future pharmacogenomic paradigms seeking to predict fenofibrate responders from both an anti-dyslipidemic and anti-inflammatory perspective
22510778 Validation in atorvastatin-treated volunteers confirmed a decrease in atorvastatin-2-hydroxylation in carriers of PPARA ngle-nucleotide polymorphisms
22479552 miR-141 suppressed HBV replication by reducing HBV promoter activities by down-regulating PPARA
22435679 L-carnitine could protect HL7702 cells against oxidative stress through the antioxidative effect and the regulation of PPAR-alpha also play an important part in the protective effect.
22378291 Interaction between PPARG Pro12Ala and PPARA Leu162Val genotypes may influence plasma LDL cholesterol concentration and the proportion as small dense LDL after a high monounsaturated fatty acids diet.
22349506 PPARalpha and PPARgamma activation modulate hENT1 expression.
22336959 Rare, potentially functional variants in PPARA may play a role in the TG response to fenofibrate
22315317 A high fat diet increased resting forkhead box class O transcription factor 1 and peroxisome proliferator-activated receptor transcription factor alpha, while decreasing pyruvate dehydrogenase complex activation.
22266374 provides the first evidence of direct BCRP regulation by PPARalpha in a human in vitro BBB model and suggests new targeting strategies for either improving drug brain bioavailability or increasing neuroprotection
22215653 Data suggest that hepatocyte expression and plasma levels of mannose-binding lectin are stimulated by PPARalpha (and fenofibrate), possibly linking PPARalpha to regulation of innate immunity/complement activation.
22205725 PPAR/RXR pathway contribute to endometrial carcinogenesis.
22168458 High PPARalpha is associated with hepatocellular carcinoma.
22092351 The PPARalpha intron 7 G/C polymorphism does not seem to influence strength characteristics in a nonathletic population.
22089192 reduced or absent PPAR-alpha expression confers a survival disadvantage in sepsis and that PPAR-alpha plays a role in maintaining appropriate immune functions during the sepsis response
22068265 Studies indicate that EPAS1, EGLN1 and PPARA genes subject to natural selection in native high-altitude Tibetans.
22065208 This study demonistrated that dysregulation of glucose metabolism contributes to the development of AD and might be due in part to genetic variations in INS and PPARA and their interaction especially in Northern Europeans.
22040870 We investigated the effect of dietary fatty acid interaction with PPARG, PPARA and ADIPOQ gene variants on plasma lipid and adiponectin concentrations...
21990353 CARHSP1 inhibits hepatic gluconeogenic gene expression via repression of PPARalpha
21785974 The results indicated that nuclear receptors PPAR-gamma and PPAR-alpha are involved in the regulation of inflammatory mediator production.
21562928 The overexpression and inhibition of miR-21 or miR-27b in HuH7 cells significantly decreased and increased the PPARalpha protein level, respectively, but not PPARalpha mRNA level.
21540177 PPARalpha is a novel regulatory factor in SREBP1c regulation which plays a relevant role in the interplay between lipids and insulin metabolic regulation
21487230 Among PPARalpha V162 carriers, subjects with higher saturated fat intakes had smaller LDL-peak particle diameters of low-density lipoprotein than those with lower intakes.
21443859 The data indicate that activation of PPARalpha stimulates both adipocyte differentiation and fatty acid oxidation in human adipocytes.
21430558 study found PPARA V162 allele of the rs1800206 polymorphism was more frequent in stage C heart failure patients than in stage A and B patients and healthy individuals
21326871 Targeting vascular NADPH oxidase 1 blocks tumor angiogenesis through a PPARalpha mediated mechanism.
21304969 serum induces CYP1A1 via the PPARalpha pathway and hexanal is one of the serum inducers. The two PPRE sites within the CYP1A1 promoter are functional and one of them is specific for PPARalpha
21291392 Ligand chirality plays the crucial role in the activation of PPAR alpha. (review)
21282101 ChREBP is a critical and direct mediator of glucose repression of PPARalpha gene expression in pancreatic beta-cells
21245137 IGF-1 is an in vivo target of PPARalpha; a PPARalpha/IGF-1 signaling pathway is involved in the protection of cardiomyocytes under ischemic and hemodynamic loading conditions
21159535 162V allele and Intron 7C allele were associated with dyslipidemia
21125992 Under hypoxic conditions, placental OCTN2 is down-regulated through PPARalpha-mediated pathways.
21030426 Observational study of genotype prevalence. (HuGE Navigator)
20862655 In HepG2 cells, activation of PPARa preferentially results in an increase in PP2A expression and induces apoptosis by increasing the pro-apoptotic BAD protein.
20855565 Observational study of gene-disease association. (HuGE Navigator)
20838448 PPARalpha promoter variant impairs ERRA and ERRG dependent transactivation and decreases mortality after acute coronary ischemia in patients with diabetes.
20838448 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20825652 The presence of the PPARalpha 162Val allele was associated with insulin resistance, but not with liver damage in NAFLD.
20825652 Observational study of gene-disease association. (HuGE Navigator)
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20810571 presence of PPARalpha has been evaluated by real-time in Graves' disease and control cells in primary culture.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20656057 PPARalpha and gamma are activated, and COX-2 is suppressed by citral, a component of lemongrass oil
20653996 Study did not reveal any significant effect of the PPARalpha and PPARgamma2 polymorphisms on anthropometric, biochemical, hormonal and psycho-behavioural characteristics in obese women.
20653996 Observational study of gene-disease association. (HuGE Navigator)
20647061 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20638986 PPARalpha and PGC-1alpha stimulate transcription of the CPT-1A gene through different regions of CPT-1A gene.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20620111 The frequency of the PPARalpha GG genotype (87% vs. 63%; p = 0.04) and G allele (93% vs. 79%; p = 0.009) were significantly higher in the elite group of the Polish rowers compared to sedentary controls.
20620111 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20496064 global dynamics of the ligand binding domain
20485444 Observational study of gene-disease association. (HuGE Navigator)
20466884 genome-wide scans reveal positive selection in regions with genes whose products likely involved in high-altitude adaptation; positively selected haplotypes of EGLN1 and PPARA associated with decreased hemoglobin unique to highland population of Tibet
20452482 Observational study of gene-disease association. (HuGE Navigator)
20450745 The C allele of PPARalpha intron 1A/C is not found to be associated with metabolic syndrome in the Chinese population, but there is an inverse association between CC genotype and hyperglycemia.
20450745 Observational study of gene-disease association. (HuGE Navigator)
20426853 Myocardial metabolism PPAR-complex genes, including within and between genes interactions, may play an important role modulating left ventricular diastolic function.
20426853 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20421589 PPAR-alpha response is generated by unbound fatty acids released locally by lipase activity and not by circulating plasma fatty acids.
20414453 PPARalpha serves as a xenobiotic and lipid sensor to regulate energy combustion, hepatic steatosis, lipoprotein synthesis, inflammation and liver cancer.
20400503 Regulation of inflammation may involve balancing proinflammatory effects of leukotriene B(4) exerted through cell-surface receptors, and anti-inflammatory effects exerted through PPAR-alpha activation.
20399568 The mRNA levels of PPAR-alpha and PPAR-gamma increased significantly in atherosclerosis
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20238044 The expression of genes involved in lipid metabolism and expression of the three isoforms of PPARs in an immortalized cell line of human retinal pigment epithelial cells, were investigated.
20214982 review of peroxisome proliferator-activated receptor (PPAR) and vitamin D receptor (VDR) signaling pathways in melanoma cells [review]
20178979 The anti-tumorigenic properties of peroxisomal proliferator-activated receptor alpha are arachidonic acid epoxygenase-mediated.
20070029 could not find an association of L162V PPAR-alpha, C161T PPAR-gamma and A(39526)AA RXR-alpha gene polymorphisms with angiographic in-stent restenosis
20070029 Observational study of gene-disease association. (HuGE Navigator)
20045185 PPARalpha may be involved in the pathophysiology of gestational diabetes, preeclampsis, and IUGR.
20044476 Observational study of gene-disease association. (HuGE Navigator)
20016041 This review primarily discusses the extrametabolic role of PPARalpha, the most studied PPAR isoform in the heart.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19948841 PLA2-modified LDL transactivates macrophage PPARalpha and PPARdelta, but not PPARgamma.
19937854 data demonstrates that transcription rates of lipoprotein lipase tended to be higher for the L162-peroxisome proliferator-activated receptor alpha (PPARalpha) polymorphism than V162-PPARalpha after n-3 fatty acids activation
19937854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19887568 PPAR alpha can selectively up-regulate beta-oxidation and decrease glucose utilization in human white adipocytes.
19878569 Observational study of gene-disease association. (HuGE Navigator)
19828088 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19823578 CYP2J2 activates the nuclear receptor PPARalpha in vitro and in vivo
19822141 Observational study of gene-disease association. (HuGE Navigator)
19789836 Levels of mRNA and protein of peroxisome proliferator-activated receptor a, which regulates b-oxidation of fatty acid, were lower in Japanese patients infected with hepatitis C virus with steatosis than in those without steatosis
19780876 Identified the effect of post-transcriptional regulation of miRNA-10b on PPAR-alpha expression to influence steatosis level in hepatocytes, which may contribute to pathogenesis of non-alcoholic fatty liver disease.
19776627 The PPARalpha L162V polymorphism may contribute to the interindividual variability in the cardiovascular disease risk factor response to n-3 PUFAs.
19748481 PPARalpha regulates the expression of human SLC25A20 via the peroxisome proliferator responsive element.
19733654 liver up-regulation of SREBP-1c and down-regulation of PPAR-alpha occur in obese patients, with enhancement in the SREBP-1c/PPAR-alpha ratio associated with n-3 LCPUFA depletion and IR
19710929 results suggest that PPARalpha activation has a major impact on gene regulation in human hepatocytes. Importantly, the role of PPARalpha as master regulator of hepatic lipid metabolism is generally well-conserved between mouse and human
19706994 The regulation and adjustment of PPARalpha activation underlying the balance of molecular cascades might resolve the progression of alcoholic liver diseases (Review)
19681917 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
19660836 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19653005 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19628794 Shear stress induces synthetic-to-contractile phenotypic modulation in smooth muscle cells via peroxisome proliferator-activated receptor alpha/delta activations by prostacyclin released by sheared endothelial cells.
19560472 Observational study of gene-disease association. (HuGE Navigator)
19527689 PPARalpha and PPARbeta/delta do not appear to modulate the alternative differentiation of human macrophages.
19458633 Peroxisome proliferator-activated receptor-alpha is a functional target of p63 in adult human keratinocytes.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19451226 Transcriptional profiling demonstrated that Bcl3 activates genes involved in diverse pathways including a subset involved in cellular energy metabolism known to be regulated by PGC-1alpha, ERRalpha, and a second nuclear receptor, PPARalpha.
19433068 results indicate that human apoA-IV is regulated directly by PPARalphavia the -2979/-2967 PPRE
19422653 Data indicate that a higher frequency of the PPAR alpha GG genotype may be associated with top-level endurance athletes.
19422653 Observational study of gene-disease association. (HuGE Navigator)
19422369 P633H, a novel dual agonist at peroxisome proliferator-activated receptors alpha and gamma, with different anti-diabetic effects in db/db and KK-Ay mice.
19420105 Observational study of gene-disease association. (HuGE Navigator)
19386311 Peroxisome proliferator-activated receptor-alpha has a role in obesity, diabetes and cardiovascular disease [review]
19367093 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19362162 These findings are consistent with the presence of a functional PPAR-binding element in the promoter of the human APOA5 gene; this element is however degenerate and non-functional in the corresponding mouse Apoa5 sequence.
19357976 Dynamic Bayesian transcriptome networks to reveal PPARalpha-dependent and -independent pathways.
19279199 Report PPAR/RXRalpha dysregulation in preterm and infection-driven infection labor.
19255064 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19254215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19223982 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19217440 Polymorphsms may increase risk of myocardial infarct.
19217440 Observational study of gene-disease association. (HuGE Navigator)
19208777 Observational study of gene-disease association. (HuGE Navigator)
19157507 Peroxisome proliferator-activated receptor expression in effusions from ovarian carcinomais associated with poor response to chemotherapy at disease recurrence and poor survival
19141539 The present data indicate that down-regulation of MMP and proteasome activities constitutes a novel mechanism of PPAR-induced protections against HIV-induced disruption of brain endothelial cells.
19119483 Peroxisome proliferator-activated receptor alpha L162V polymorphism tends to occur in HBV-induced hepatocellular carcinoma and is absent in HCV-related hepatocellular carcinoma.
19118026 PPARgamma will preferentially bind with retinoid X receptor alpha and signal antiproliferative, antiangiogenic, and prodifferentiation pathways in several tissue types, thus making it a highly useful target for down-regulation of carcinogenesis
19115207 A-FABP is a candidate progression marker of human transitional cell carcinoma of the bladder that is differentially regulated by PPAR in urothelial cancer cells
19070893 Term human labour is associated with changes in expression and activity of PPAR isoforms and its transcription partner, RXRalpha.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18981151 the response of the pleural mesothelium to LTB4 is the result of a balance between the activation of receptors for LTB4 with a proinflammatory outcome (BLT2) and the activation of a different receptor for LTB4 with an anti-inflammatory outcome (PPAR).
18977277 Observational study of gene-disease association. (HuGE Navigator)
18955051 Endogenous PPARalpha regulates PDZK1 expression.
18855529 Interaction between PPARA genotype and beta-blocker treatment influences clinical outcomes following acute coronary syndromes.
18855529 Observational study of gene-disease association. (HuGE Navigator)
18853997 PPAR-alpha val227ala polymorphism may be involved in the pathogenesis of non-alcoholic fatty liver disease and play a protective role in obesity.
18853997 Observational study of gene-disease association. (HuGE Navigator)
18848838 stimulation of PPARalpha in human macrophages might reduce arterial inflammation through differential regulation of the Trx-1 and VDUP-1 gene expression
18797151 lower transactivity of PPAR delta for arachidonic acid in Caco-2 cells, compared with PPAR alpha, is associated with the binding activity of p300 to the receptor
18787507 Observational study of gene-disease association. (HuGE Navigator)
18786524 PPAR-alpha and PGC-1A polymorphisms are associated with alcohol consumption in the Mediterranean population
18786524 Observational study of gene-disease association. (HuGE Navigator)
18727927 PAR-5359, a well-balanced PPARalpha/gamma dual agonist, exhibits equivalent antidiabetic and hypolipidemic activities in vitro and in vivo.
18726867 L162V SNP does not have a strong impact on the pathogenesis of type 2 diabetes or obesity
18726867 Observational study of gene-disease association. (HuGE Navigator)
18725353 The results of genetic variants analysis revealed that L162V PPARalpha polymorphism would not be present among Senegalese black population, and consequently, should not be involved in diabetes onset.
18725353 Observational study of gene-disease association. (HuGE Navigator)
18713766 Report activation of human PPARalpha by perfluoroalkyl acids of different functional groups and chain lengths.
18710415 PPARalpha and PPARgamma over-expression prevent Tat-induced binding activity and transactivation of nuclear factor-kappaB
18680716 FGF21 circulates in human plasma and increases by extreme fasting and PPARalpha activation.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18652775 Results show that a persistent upregulation of PPAR-alpha binding activity and protein expression occurred in injured cortex after traumatic brain injury, which peaked 24 - 72 hours post-injury.
18586686 variants of PPARA modify the association between breast cancer and aspirin use.
18586686 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18549840 Gene-wide variations in PPARA and TLR4 genes were associated with MI. The minor allele of the PPARA SNP, rs4253623, was associated with a higher risk of MI.
18549840 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18541586 PPARA 3'UTR SNPs modulate the association between lipid concentrations and dietary n-6 fatty acid intake in whites and long-chain n-3 fatty acid intake in blacks.
18541586 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18518955 PPARalpha in human PBMCs regulates fatty acid and amino acid metabolism and PBMCs are a suitable model to study changes in PPARalpha activation in healthy humans.
18440986 Overexpression of human truncated peroxisome proliferator-activated receptor alpha induces apoptosis in HL-1 cardiomyocytes.
18398047 Observational study of gene-disease association. (HuGE Navigator)
18394939 Stable structures and electronic properties for the complexes of PPARalpha and phthalate as well as adipate esters, were investigated.
18388689 polymorphisms in peroxisome proliferator-activated receptors are critical susceptibility risk factors for dyslipidemias and diabetes [review]
18336366 Observational study of gene-disease association. (HuGE Navigator)
18313368 Current findings of PPARalpha and gamma open up the possibility of developing new therapeutic agents that modulate these nuclear receptors to control various inflammatory diseases.
18292238 investigation of the functional significance of the V227A substitution affecting PPARalpha hinge region; results provide first indication that defective function of a natural PPARalpha variant was due at least partially to increased corepressor binding
18268046 PPAR alpha and PPAR gamma activation stimulates neoangiogenesis in umbilical veins through a VEGF-dependent mechanism.
18255343 Dehydroepiandrosterone sulfate inhibits endothelial inflammatory processes by a PPAR-alpha mechanism.
18245819 fibrates simultaneously decreased PCSK9 expression while increasing PC5/6A and furin expression, indicating a broad action of PPARalpha activation in proprotein convertase-mediated lipid homeostasis.
18219093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18184928 Hepatic PPARalpha activation may provide an explanation for telmisartan's antidyslipidemic actions observed in recent clinical trials.
18182682 review of role of activation of PPARalpha, -beta/delta, or -gamma or LXRs in skin physiology and cytology and disease
18172578 Both mouse and human melanoma cells produced more PPARalpha and PPARgamma protein compared to melanocytes.
18061194 Two PPARA SNPs, L162V and rs4253728 (intronic), are less prevalent in African-Americans than in Caucasians and in African-Americans only are associated with higher apoCIII and TG levels.
18061194 Observational study of gene-disease association. (HuGE Navigator)
18004978 PPARalpha,gamma DNA methylation induced by Hcy may represent an important mechanism to explain atherosclerosis.
18003597 Ethanol and acetaldehyde inhibited PPAR-alpha transactivation.
17998026 PPAR-alpha mRNA expression is down-regulated in the liver of rats with chronic kidney failure and this down-regulation may play a role in the development of dyslipidemia.
17991667 PBMC gene expression profiles reflect nutrition-related metabolic changes such as fasting and that part of the fasting-induced changes are likely regulated by PPARalpha.
17963696 Hence the anti-inflammatory effect of PPARalpha overrides the pro-inflammatory effect of AhR.
17962186 PPARalpha ligands not only serve as PPARalpha agonists but possibly act as CAR antagonists.
17951966 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17951966 Finds influence of drinking, aging or exercise on TC, LDL-C and HDL-C levels in A227 carriers may be different from those in PPARA-WT subjects in Japan.
17926914 Observational study of gene-disease association. (HuGE Navigator)
17850927 We found no significant differences in genotype or allele distributions between AD patients and controls. None of the PPAR-alpha gene variants influenced markers for AD.
17850927 Observational study of gene-disease association. (HuGE Navigator)
17705849 Observational study of gene-disease association. (HuGE Navigator)
17705849 Our results on association of PPARalpha and triglycerides in males showed a much larger effect of the V allele than previously reported in older and less healthy populations
17700210 Observational study of gene-disease association. (HuGE Navigator)
17655842 PPAR-alpha is not involved in the early regulation of delta5 desaturase gene by simvastatin, in THP-1 cells.
17646210 PPARalpha controls gene expression in human white adipocytes
17616429 Interleukin-6 inhibits human peroxisome proliferator activated receptor alpha gene expression via CCAAT/enhancer-binding proteins in hepatocytes.
17608096 Observational study of gene-disease association. (HuGE Navigator)
17492134 Peroxisome proliferator-activated receptor alpha/gamma ligands can down-regulate iNOS DNA methylation
17436029 Formation of a ligand for the nuclear receptor PPARalpha may be one possibility by which 12R-LOX and eLOX3 contribute to epidermal differentiation.
17431031 Cytochrome P450 eicosanoids are agonists of PPAR alpha.
17363837 Data suggest that PPARalpha variants may modulate the risk of cardiovascular disease by influencing both fasting and postprandial lipid concentrations.
17363697 Transgenic mice with cardiac-restricted overexpression of PPAR alpha exhibit myocyte lipid accumulation and cardiac dysfunction.
17356846 REVIEW: PPARalpha has been shown to control transcriptional expression of key enzymes that are involved in fatty acid (FA) uptake and oxidation, triglyceride synthesis, mitochondrial respiration uncoupling, and glucose metabolism.
17355223 Data suggest that activator protein 2alpha and peroxisome-proliferator-activated receptor alpha may be especially involved in the ozone-inducible up-regulation mechanism of bombesin receptor subtype 3 expression.
17342071 Combined with abdominal obesity, epistasis in the VLDL pathway (lipoprotein lipase, apolipoprotein CIII, hepatic lipase, PPARalpha, PPARgamma, and apo E genes) has a deleterious effect on fasting triglycerides and coronary artery disease risk profile
17331954 PPARalpha transgenic mice that target constitutively activated PPARalpha specifically to hepatocytes do not develop hepatocellular carcinomas, even though they exhibit peroxisome proliferation and hepatocyte proliferation.
17317762 Single nuscleotide polymorphisms of PPARA increase the risk of type 2 diabetes alone and in combination with the SNPs of other genes acting closely with PPAR-alpha.
17300045 Observational study of gene-disease association. (HuGE Navigator)
17272748 Observational study of gene-disease association. (HuGE Navigator)
17244467 The PPAR-alpha Val227Ala polymorphism is associated with non-alcoholic fatty liver disease.
17200111 Residues in PPAR alpha AF-2 transcription factor domain determine the positioning of helix 12 in the active conformation in the absence of a ligand.
17184146 PPAR-alpha agonist fenofibrate did not significantly affect insulin sensitivity or resistin/adiponectin concentrations in obese subjects with type 2 diabetes mellitus.
17181634 Differential transcription occurring early in atopic dermatitis skin was indicated for CCL18, CCL13, IFNalpha2, PPARalpha and PPARgamma.
17150915 Selected genes (long-chain fatty-acid-CoA ligase (FACL1), carnitine palmitoyltransferase 1A (CPT1A), adipose differentiation-related protein (ADRP) and aquaporin 3 (AQP3) were down-regulated by PPARalpha siRNA in a kidney tumor cell line.
17129741 Observational study of gene-disease association. (HuGE Navigator)
17084382 In conclusion, CEOOH present in oxidized LDL increase CD36 gene expression in a pathway involving PPARalpha.
17008383 metabolism of a parent compound, beta-carotene, may alternatively activate (9-cisRA) or inhibit (beta-apo-14'-carotenal) specific RXR and PPAR responses
17001213 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16956579 myeloperoxidase is regulated by LXR and PPARalpha ligands
16875506 Diminished lymphocytic expression of PPAR alpha and its activity may contribute to the inflammatory processes that are observed in cystic fibrosis.
16847426 Observational study of genotype prevalence, gene-disease association, and gene-environment interaction. (HuGE Navigator)
16847426 PPARalpha-V227A is a major polymorphism in the Japanese population, and its activity may be greater compared to wild-type, but decreased by alcohol drinking.
16822823 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16763159 Observational study of gene-disease association. (HuGE Navigator)
16652134 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16637234 Observational study of genotype prevalence. (HuGE Navigator)
16630553 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16511589 This review focuses on the mechanisms of action of PPAR alpha in metabolic diseases and their associated vascular pathologies.
16506057 Observational study of gene-disease association. (HuGE Navigator)
16506057 In conclusion, PPARalpha intron 7 G/C polymorphism was associated with physical performance in Russian athletes/
16492688 Thioredoxin inhibited the binding of PPARalpha to the PPAR-response element.
16416313 Observational study of gene-disease association. (HuGE Navigator)
16377806 structural differences between human and mouse PPARalpha are responsible for the differential susceptibility to the peroxisome proliferator-induced hepatocarcinogenesis
16309557 Observational study of gene-disease association. (HuGE Navigator)
16297361 Observational study of gene-disease association. (HuGE Navigator)
16288986 data show that PPARalpha activation causes an increased nephrin expression by a dual action, on the one hand by stimulating nephrin promoter activity and on the other hand by reducing nephrin mRNA degradation
16288935 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16288935 Our findings implicate PPARalpha in the lipid lowering associated with diets high in PUFA and suggests that genetic variation at the PPARA locus may determine the lipid response to changes in PUFA intake
16285997 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16275545 Observational study of gene-disease association. (HuGE Navigator)
16271724 a conserved functional PPAR responsive element downstream of the transcriptional start site of the human CPT1A gene is localized; this sequence is fundamental for fatty acids or PGC1-induced transcriptional activation of the CPT1A gene
16239970 PPAR alpha controls vascular smooth muscle cell-cycle progression at the G1/S transition by targeting cyclin-dependent kinase inhibitor and tumor suppressor p16INK4a
16226051 Data show that estrogen receptor alpha (ERa) reduces levels of peroxisome proliferator-activated receptor alpha (PPARa) in breast cancer cell lines, and that reduction of ERa by sodium butyrate results in an increase in PPARa expression.
16221474 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16221474 a L162V polymorphism at the peroxisome proliferator activated receptor alpha locus modulates the risk of cardiovascular events associated with insulin resistance and diabetes mellitus
16162941 NPC1 and NPC2 mRNA depletion using small interfering RNA, abolished ABCA1-dependent cholesterol efflux induced by PPARalpha activators
16043164 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16043164 variant frequencies of ICAM1, APOE, PPARA and PAI-1 genes in coronary artery disease patients and healthy blood donors; specific arrangement of polymorphic variants which differentiate both groups
15940190 Observational study of gene-disease association. (HuGE Navigator)
15935279 Phe273Ala mutation dramatically reduced the binding affinity of ligands to PPARalpha; solvent effect may be concluded as the major source of the decrease of binding affinity and thereby of the decrease of its transcriptional activation activity
15888456 the ligand-independent tight control of the position of the PPAR helix 12 provides an effective alternative for establishing an interaction with CoA proteins
15811118 Less likely to occur in squamous cell carcinoma and actinic keratosis than in normal skin.
15797250 PPARalpha has a role in CYP4X1 regulation, and the glucocorticoid and progesterone receptors have roles in CYP4Z1 gene activation
15759454 Clinical trial of gene-disease association. (HuGE Navigator)
15735069 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15735069 Effect of the L162V polymorphism on plasma TG and apoC-III concentrations depends on the dietary PUFA, with a high intake triggering lower TG in carriers of the 162V allele.
15699916 Observational study of gene-disease association. (HuGE Navigator)
15699244 Observational study of gene-environment interaction. (HuGE Navigator)
15685545 PPARalpha is one mechanism underlying the pathogenesis of hepatitis C infection.
15677519 Observational study of gene-disease association. (HuGE Navigator)
15677519 PPARalpha gene intron variants influence age at diagnosis of typw 2 diabetes.
15642120 Activation of both PPARgamma and PPARalpha may contribute to the improvement in insulin sensitivity
15608561 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15608561 Response to procetofen is associated with PPARA in subjects with type 2 diabetes.
15549499 Observational study of genotype prevalence. (HuGE Navigator)
15539630 PPAR-alpha activation increases intracellular concentrations of ROS, through the activation of NADPH oxidase.
15521013 new cytochrome P450 1A1 induction pathway involving peroxisome proliferator-activated receptor-alpha and 2 peroxisome proliferator response element sites.
15500444 CLOCK plays an important role in lipid homoeostasis by regulating the transcription of a key protein, PPARalpha
15497675 This paper focuses on the functions of PPAR-alpha in fatty acid beta-oxidation, lipid metabolism, and vascular inflammation. PPAR-alpha genetics, the clinical use of PPAR-alpha activators and their future perspective are also discussed.
15456881 Data suggest that ERRalpha serves as a nodal point in the regulatory circuitry downstream of PGC-1alpha to direct the transcription of genes involved in mitochondrial energy-producing pathways in cardiac and skeletal muscle.
15318936 PPAR-alpha and PPAR-gamma ligands induced apoptotic and antiproliferative responses in human breast cancer cell lines, respectively, which were associated with specific changes in gene expression.
15309680 Observational study of gene-disease association. (HuGE Navigator)
15258199 BF may enhance the capacity of human hepatocytes to direct PC into bile canaliculi via PPARalpha-mediated redistribution of ABCB4 to the canalicular membrane
15231516 The antiinflammatory effects of fish oil may result from the inhibitory effects of oxidized omega-3 fatty acids on NF-kappaB activation via a PPARalpha-dependent pathway.
15199365 Observational study of gene-disease association. (HuGE Navigator)
15199365 data suggest that the PPARalpha polymorphism L162V might protect against the development of atherosclerosis or coronary heart disease in patients with diabetes mellitus type 2
15196699 Genistein activated transcriptional activity of PPARalpha in fatty acid catabolism.
15131257 PPARalpha S179A-S230A protein displays an impaired ligand-induced transactivation activity and an enhanced trans-repression activity
15128052 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15111510 Observational study of gene-disease association. (HuGE Navigator)
15083308 Observational study of gene-disease association. (HuGE Navigator)
15083308 Our findings argue against a significant contribution of PPARalpha variations to the genetic basis of psoriasis.
15067378 PPARalpha and HNF-4 competitively affect the human angiotensinogen promoter through the C region
15051727 PPARalpha and CITED2 proteins may participate in signaling cascades of hypoxic response and angiogenesis
15001550 Only SRC-2 serves as a true coactivator for PPARdelta, whereas all SRC members could enhance PPARalpha-induced transcriptional activation.
15001458 PPARalpha protects EC from glucose-mediated monocyte adhesion, in part through regulation of IL-6 production.
14764586 chronic treatment with the PPARalpha agonist fully prevents the acute phase response gene expression in wild-type but not in PPARalpha-deficient mice
14730379 In type 2 diabetes there is a significant gene to gene interaction between the Ala55Val polymorphism in the uncoupling protein 2 gene ( UCP2) and the 161C>T polymorphism in the exon 6 of ppargamma.
14677049 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14671555 Observational study of gene-disease association. (HuGE Navigator)
14641801 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14633846 Increases in PGC-1 and PPAR-alpha levels may play an important role in changes in muscle mitochondria content, oxidative phenotype, and sensitivity to insulin induced by endurance training.
14523052 PPARalpha transcription factor as a major factor governing hepatic CoA levels by specific modulation of PANK1alpha gene expression
14519597 In humans skeletal muscle PPARalpha expression and genes regulating lipid metabolism are tightly linked, but there was no association between both insulin sensitivity and BMI with PPARalpha expression in skeletal muscle.
14515181 agonists of PPAR alpha increased basal and insulin-stimulated PAI-1 antigen release with a mechanism involving gene transcription and requiring signaling through the ERK1/2 signaling pathway
12938026 Observational study of gene-disease association. (HuGE Navigator)
12914524 PPARalpha/RXRalpha complex was counteracted by the expression of ERRalpha in HeLa cells.
12897377 ARA70, a coactivator of the androgen receptor and PPARgamma, was identified as a ligand-enhanced coactivator of peroxisome proliferator-activated receptor alpha in a prostate cancer cell line.
12855749 Observational study of gene-disease association. (HuGE Navigator)
12855749 peroxisome proliferator-activated receptor alpha V162 allele is associated with reduced adiposity
12847522 These results identify hepatic activation of peroxisome proliferator-activated receptor-alpha as a mechanism underlying glucocorticoid-induced insulin resistance.
12835617 Observational study of gene-disease association. (HuGE Navigator)
12835617 There seems to be an association between the polymorphism of the PPARA gene and decreased fasting serum triglyceride levels in glucose tolerant subjects.
12810707 PPARA has a role as an important modulator of the metabolism of endobiotics and xenobiotics in human hepatocytes
12745064 Molecular characterisation of six alternatively spliced variants and a novel promoter in peroxisome proliferator-activated receptor alpha.
12709436 PPARalpha regulates the human apolipoprotein AV gene
12655356 decrease in cardiac PPARalpha transcription factor gene expression observed in the failing human heart could play an important role in a reduction in fatty acid utilisation by the adult heart during cardiac hypertrophy
12615366 TR2 and TR4 can have distinct functions. Existence of differential and bi-directional regulation between PPAR alpha and TR2/TR4. Possible roles in PPAR alpha signaling pathway in human keratinocytes.
12594814 Expression of peroxisome proliferator-activated receptors (PPARs) in human urinary bladder carcinoma and growth inhibition by its agonists.
12594295 The PPAR alpha subtype localizes to the nuclear and perinuclear regions of human airway smooth muscle cells.
12554753 These results provide molecular evidence for a cross-talk between the FXR and PPARalpha pathways in humans.
12544508 Observational study of gene-environment interaction. (HuGE Navigator)
12468272 Observational study of gene-disease association. (HuGE Navigator)
12468272 PPARA gene is a modifier of the familial combined hyperlipidemia phenotype
12408750 5'-flanking region of this gene is transcriptionally active and binds PPARalpha, we characterized the peroxisome proliferator-responsive element in the proximal promoter of the CPT II gene, which appears to be a novel PPRE.
12395215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12203367 Our results established the presence of PPARalpha in human breast cancer cell lines and showed for the first time that activation of PPARalpha in human breast cancer cells promoted proliferation.
12163133 PPARalpha binding characteristics by FRET.
12161442 PPARalpha is regulated by fatty acids in human cells
12118038 redundancy in the functions of PPARs alpha and delta as transcriptional regulators of fatty acid homeostasis and suggest that in skeletal muscle high levels of the delta-subtype can compensate for deficiency of PPAR alpha
12118000 turnover is predicted by the ubiquitin-proteasome system which controls the ligand-induced expression level of its target genes
12055195 regulation of human ASBT gene by PPARalpha
12048138 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12042669 Observational study of gene-environment interaction. (HuGE Navigator)
12023905 PPARalpha binds to apolipoprotein a enhancers and influences estrogen-mediated transcription
12006394 Observational study of gene-disease association. (HuGE Navigator)
12006394 PPARA L162V polymorphism is associated with increase in plasma LDL cholesterol levels.
11981036 the organization of the 5'-flanking and untranslated region of the hPPARalpha gene was characterized and the hPPARalpha promoter region has been identified
11980898 differential regulation of vascular endothelial growth factor expression in bladder cancer cells (peroxisome proliferative activated receptor, beta)
11940516 The results suggest that homocysteine may enhance vascular constrictive remodeling by inactivating PPAR-alpha and -gamma in ECs and PPAR-gamma in SMCs.
11934839 activation of PPARalpha in human CD4-positive T cells limits the expression of proinflammatory cytokines, such as IFNgamma
11914252 Observational study of gene-disease association. (HuGE Navigator)
11897821 A Val227Ala polymorphism in the peroxisome proliferator activated receptor alpha (PPARalpha) gene is associated with variations in serum lipid levels.
11897617 cPLA(2) plays a critical role in PPAR-mediated gene transcription in HepG2 cells
11864924 Observational study of gene-disease association. (HuGE Navigator)
11864924 Variation in the PPAR gene influences human left ventricular growth in response to exercise and hypertension
11852057 Peroxisome proliferator-activated receptor (PPARalpha and PPARgamma) agonists decrease lipoprotein lipase secretion and glycated LDL uptake by human macrophages.
11845213 crystal structure of a ternary complex containing the peroxisome proliferator-activated receptor-alpha ligand-binding domain bound to the antagonist GW6471 and a SMRT co-repressor motif
11840500 polymorphism is unrelated to schizophrenia or alcoholism.
11668221 Observational study of gene-disease association. (HuGE Navigator)
11466580 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11409711 Observational study of gene-disease association. (HuGE Navigator)
11119019 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITD      1 - 70
TLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCD     71 - 140
RSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRI    141 - 210
YEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTS    211 - 280
VETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKP    281 - 350
FCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI    351 - 420
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY                          421 - 468
//

Text Mined References (495)

PMID Year Title
26775637 2016 IP-receptor and PPARs trigger the conversion of human white to brite adipocyte induced by carbaprostacyclin.
26722456 2015 Prognostic role of PPAR-? and PTEN in the renal cell carcinoma.
26718439 2015 Differential effects of peroxisome proliferator-activated receptor agonists on doxorubicin-resistant human myelogenous leukemia (K562/DOX) cells.
26673968 2015 Screening of Peroxisome Proliferator-Activated Receptors (PPARs) ?, ? and ? Gene Polymorphisms for Obesity and Metabolic Syndrome Association in the Multi-Ethnic Malaysian Population.
26671025 2016 Functional Genetic Variants of PPARx03B3; and PPAR? Encoding Peroxisome Proliferator-Activated Receptors and Susceptibility to Ischemic Stroke in Chinese Han Population.
26617775 2015 Fenofibrate, a PPAR? agonist, protect proximal tubular cells from albumin-bound fatty acids induced apoptosis via the activation of NF-kB.
26577021 2016 Eicosapentaenoic acid inhibits intestinal ?-carotene absorption by downregulation of lipid transporter expression via PPAR-? dependent mechanism.
26556865 2015 PPAR? induces cell apoptosis by destructing Bcl2.
26504087 2015 Reactive Oxygen Species (ROS) Mediate p300-dependent STAT1 Protein Interaction with Peroxisome Proliferator-activated Receptor (PPAR)-? in CD36 Protein Expression and Foam Cell Formation.
26497374 2015 Study on association of peroxisome proliferator-activated receptor ? with C-reactive protein, and additional gene-gene interaction in Chinese Han.
26472199 2015 Stimulation of PPAR? normalizes the skin lipid ratio and improves the skin barrier of normal and filaggrin deficient reconstructed skin.
26460070 2015 Peroxisome proliferator-activated receptor-?-mediated transcription of miR-301a and miR-454 and their host gene SKA2 regulates endothelin-1 and PAI-1 expression in sickle cell disease.
26449539 2015 The impact of PPAR? activation on whole genome gene expression in human precision cut liver slices.
26443578 2015 Peroxisome Proliferator Activated Receptor-? Association With Silent Information Regulator 1 Suppresses Cardiac Fatty Acid Metabolism in the Failing Heart.
26387026 2015 9-Oxo-10(E),12(Z),15(Z)-Octadecatrienoic Acid Activates Peroxisome Proliferator-Activated Receptor ? in Hepatocytes.
26380295 2015 Gene Network Analysis of Glucose Linked Signaling Pathways and Their Role in Human Hepatocellular Carcinoma Cell Growth and Survival in HuH7 and HepG2 Cell Lines.
26334901 2015 Donor PPAR? Gene Polymorphisms Influence the Susceptibility to Glucose and Lipid Disorders in Liver Transplant Recipients: A Strobe-Compliant Observational Study.
26330104 2015 Effect of miR-34a in regulating steatosis by targeting PPAR? expression in nonalcoholic fatty liver disease.
26122096 2015 The truncated splice variant of peroxisome proliferator-activated receptor alpha, PPAR?-tr, autonomously regulates proliferative and pro-inflammatory genes.
26098621 2015 Association and interaction of PPAR?, ?, and ? gene polymorphisms with low-density lipoprotein-cholesterol in a Chinese Han population.
26093984 2015 Expression of 15-Hydroxyprostaglandin Dehydrogenase in Human Chorion Is Associated with Peroxisome Proliferator-Activated Receptor Isoform Expression in Term Labor.
26070013 2015 A Selective Novel Peroxisome Proliferator-Activated Receptor (PPAR)-? Antagonist Induces Apoptosis and Inhibits Proliferation of CLL Cells In Vitro and In Vivo.
25986483 2015 A candidate gene study reveals association between a variant of the Peroxisome Proliferator-Activated Receptor Gamma (PPAR-?) gene and systemic sclerosis.
25979856 2015 An experimental study on amelioration of dyslipidemia-induced atherosclesis by Clematichinenoside through regulating Peroxisome proliferator-activated receptor-? mediated apolipoprotein A-I, A-II and C-III.
25970251 2015 PPAR-? and glucocorticoid receptor synergize to promote erythroid progenitor self-renewal.
25920026 2015 Association of functional genetic variants in PPAR? and PPAR? encoding peroxisome proliferator-activated receptors with ischemic stroke in a unique Chinese population.
25847235 2015 Fatty Acid-binding Proteins 1 and 2 Differentially Modulate the Activation of Peroxisome Proliferator-activated Receptor ? in a Ligand-selective Manner.
25826986 2014 [Genotype and allele frequencies of UCP and PPAR gene families in residents of besieged Leningrad and in the control group].
25825462 2015 Men and women differ in their diurnal expression of monocyte peroxisome proliferator-activated receptor-? in the fed but not in the fasted state.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25758678 2015 Changes in plasma PPARs levels in migraine patients.
25734487 2015 The Mechanism of Interferon Refractoriness During Hepatitis C Virus Infection and Its Reversal with a Peroxisome Proliferator-Activated Receptor ? Agonist.
25722086 2015 High-glucose-increased expression and activation of NADPH oxidase in human vascular smooth muscle cells is mediated by 4-hydroxynonenal-activated PPAR? and PPAR?/?.
25703085 2015 PPAR? gene expression correlates with severity and histological treatment response in patients with non-alcoholic steatohepatitis.
25691623 2015 Activation of nuclear factor erythroid 2-related factor 2 coordinates dimethylarginine dimethylaminohydrolase/PPAR-?/endothelial nitric oxide synthase pathways that enhance nitric oxide generation in human glomerular endothelial cells.
25670618 2015 Carbon ion beam triggers both caspase-dependent and caspase-independent pathway of apoptosis in HeLa and status of PARP-1 controls intensity of apoptosis.
25575492 2015 PPAR? signaling in the hippocampus: crosstalk between fat and memory.
25566967 2015 Fenofibrate induces G0/G1 phase arrest by modulating the PPAR?/FoxO1/p27 kip pathway in human glioblastoma cells.
25548431 2014 Peroxisome proliferator-activated receptors family is involved in the response to treatment and mild clinical course in patients with ulcerative colitis.
25533124 2015 Steatogenesis in adult-onset type II citrullinemia is associated with down-regulation of PPAR?.
25516156 2015 Peroxisome proliferator-activated receptors ? and ? are linked with alcohol consumption in mice and withdrawal and dependence in humans.
25500634 2015 Changes in gene expression in PBMCs profiles of PPAR? target genes in obese and non-obese individuals during fasting.
25496486 2015 Abietic acid inhibits UVB-induced MMP-1 expression in human dermal fibroblast cells through PPAR?/? dual activation.
25461249 2015 PPARA gene and phenprocoumon: a new predictor of response variability.
25428568 2015 Chemical and protein structural basis for biological crosstalk between PPAR? and COX enzymes.
25389292 2014 Peroxisome proliferator-activated receptor-?-mediated transcription of miR-199a2 attenuates endothelin-1 expression via hypoxia-inducible factor-1?.
25379721 2015 Genetic variants within obesity-related genes are associated with tumor recurrence in patients with stages II/III colon cancer.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25370040 2015 Novel genomic signals of recent selection in an Ethiopian population.
25327562 2014 Peroxisome proliferator activated receptor alpha inhibits hepatocarcinogenesis through mediating NF-?B signaling pathway.
25291031 2014 ?(9)-THC modulation of fatty acid 2-hydroxylase (FA2H) gene expression: possible involvement of induced levels of PPAR? in MDA-MB-231 breast cancer cells.
25225039 2015 Spatio-temporal expression of peroxisome proliferator-activated receptor ? during human prenatal development.
25198533 2014 PPARA intron polymorphism associated with power performance in 30-s anaerobic Wingate Test.
25193434 2014 Differential effects of triclosan on the activation of mouse and human peroxisome proliferator-activated receptor alpha.
25165883 2014 Peroxisome proliferator-activated receptor ? activation attenuates the inflammatory response to protect the liver from acute failure by promoting the autophagy pathway.
25087592 2014 PPAR?-L162V polymorphism is not associated with schizophrenia risk in a Croatian population.
25052003 2014 Clofibric acid induces hepatic CYP 2B1/2 via constitutive androstane receptor not via peroxisome proliferator activated receptor alpha in rat.
25003192 2014 Periostin promotes liver steatosis and hypertriglyceridemia through downregulation of PPAR?.
24996283 2014 PPAR-? and PPARGC1A gene variants have strong effects on aerobic performance of Turkish elite endurance athletes.
24976416 2014 A genetic variant of PPARA modulates cardiovascular risk biomarkers after milk consumption.
24928010 2014 [Expression of peroxisome proliferators-activated receptor in glioma and its effect on the growth of human glioma cells].
24880474 2014 Analysis on the association between PPAR?/? polymorphisms and lipoprotein(a) in a Chinese Han population.
24876382 2014 Hypoxia-inducible lipid droplet-associated (HILPDA) is a novel peroxisome proliferator-activated receptor (PPAR) target involved in hepatic triglyceride secretion.
24875102 2014 Human FABP1 T94A variant impacts fatty acid metabolism and PPAR-? activation in cultured human female hepatocytes.
24829353 2014 Endoplasmic reticulum stress links hepatitis C virus RNA replication to wild-type PGC-1?/liver-specific PGC-1? upregulation.
24751833 2014 PPAR-alpha dependent regulation of vanin-1 mediates hepatic lipid metabolism.
24713062 2014 Ligand-regulated heterodimerization of peroxisome proliferator-activated receptor ? with liver X receptor ?.
24675006 2014 PPAR? gene polymorphisms modulate the association between physical activity and cardiometabolic risk.
24657893 2014 Cardiomyocyte specific peroxisome proliferator-activated receptor-? overexpression leads to irreversible damage in ischemic murine heart.
24657322 MAPK-PPAR?/? signal transduction pathways are involved in Chlamydia pneumoniae-induced macrophage-derived foam cell formation.
24639097 2014 MicroRNA-518d regulates PPAR? protein expression in the placentas of females with gestational diabetes mellitus.
24606127 2014 Adiponectin inhibits insulin function in primary trophoblasts by PPAR?-mediated ceramide synthesis.
24585388 2014 The role of albumin and PPAR-? in differentiation-dependent change of fatty acid profile during differentiation of mesenchymal stem cells to hepatocyte-like cells.
24467636 2014 The dual PPAR?/? agonist aleglitazar increases the number and function of endothelial progenitor cells: implications for vascular function and atherogenesis.
24460649 2014 PPAR ? and PPAR ? polymorphisms as risk factors for dyslipidemia in a Chinese Han population.
24444220 2014 Variation in the ACE, PPARGC1A and PPARA genes in Lithuanian football players.
24368768 2014 Down-regulated peroxisome proliferator-activated receptor ? (PPAR?) in lung epithelial cells promotes a PPAR? agonist-reversible proinflammatory phenotype in chronic obstructive pulmonary disease (COPD).
24315978 2014 Role of PPAR, LXR, and PXR in epidermal homeostasis and inflammation.
24309288 2014 Resveratrol protects RPE cells from sodium iodate by modulating PPAR? and PPAR?.
24277691 2014 Influence of breastfeeding on blood-cell transcript-based biomarkers of health in children.
24232815 2013 Influence of PPARA, RXRA, NR1I2 and NR1I3 gene polymorphisms on the lipid-lowering efficacy and safety of statin therapy.
24169559 2014 Reduced expression of 11?-hydroxysteroid dehydrogenase type 2 in preeclamptic placentas is associated with decreased PPAR? but increased PPAR? expression.
24140347 2013 PPARalpha regulates the production of serum Vanin-1 by liver.
24138287 2014 Caffeic acid induces keratinocyte differentiation by activation of PPAR-?.
24122873 2014 Peroxisome proliferator-activated receptor ? activates human multidrug resistance transporter 3/ATP-binding cassette protein subfamily B4 transcription and increases rat biliary phosphatidylcholine secretion.
24113216 2013 Single-nucleotide polymorphisms in P450 oxidoreductase and peroxisome proliferator-activated receptor-? are associated with the development of new-onset diabetes after transplantation in kidney transplant recipients treated with tacrolimus.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24068329 2014 Peroxisome proliferator-activated receptor-? activation protects against endoplasmic reticulum stress-induced HepG2 cell apoptosis.
24043310 2013 SIRT4 represses peroxisome proliferator-activated receptor ? activity to suppress hepatic fat oxidation.
23951092 2013 Inhibition of PPAR? induces cell cycle arrest and apoptosis, and synergizes with glycolysis inhibition in kidney cancer cells.
23930676 2013 Genetic variation in the PPARA gene is associated with simvastatin-mediated cholesterol reduction in the Rotterdam Study.
23919842 2013 Association between APOE, SCARB1, PPAR? polymorphisms and serum lipids in a population of Lithuanian adults.
23891824 2013 Peroxisome proliferator-activated receptors alpha and gamma2 polymorphisms in nonalcoholic fatty liver disease: a study in Brazilian patients.
23821302 2013 Regulation of URG4/URGCP and PPAR? gene expressions after retinoic acid treatment in neuroblastoma cells.
23814018 2013 PPAR? and fatty acid oxidation mediate glucocorticoid resistance in chronic lymphocytic leukemia.
23811234 2013 PPAR activation as a regulator of lipid metabolism, nitric oxide production and lipid peroxidation in the placenta from type 2 diabetic patients.
23797899 2013 Divergence between human and murine peroxisome proliferator-activated receptor alpha ligand specificities.
23736812 2013 Epigenetic modulation of signal transduction pathways in HPV-associated HNSCC.
23711995 2013 Human mannose-binding lectin 2 is directly regulated by peroxisome proliferator-activated receptors via a peroxisome proliferator responsive element.
23707408 2013 Molecular mechanism of peroxisome proliferator-activated receptor ? activation by WY14643: a new mode of ligand recognition and receptor stabilization.
23666678 2013 Pro12Ala variant of the PPARG2 gene increases body mass index: An updated meta-analysis encompassing 49,092 subjects.
23657974 2014 Adipogenic differentiation is impaired in replicative senescent human subcutaneous adipose-derived stromal/progenitor cells.
23645771 2013 Complete necrosis of a giant cell tumor with high expression of PPAR?: a case report.
23583468 2013 Different effects of PPARA, PPARG and ApoE SNPs on serum lipids in patients with coronary heart disease based on the presence of diabetes.
23567058 2013 A fatty gut feeling.
23522297 2013 Higher expression of peroxisome proliferator-activated receptor ? or its activation by agonist thiazolidinedione-rosiglitazone promotes bladder cancer cell migration and invasion.
23502212 2013 Molecular determinants for nuclear receptors selectivity: chemometric analysis, dockings and site-directed mutagenesis of dual peroxisome proliferator-activated receptors ?/? agonists.
23476056 2013 Broad suppression of NADPH oxidase activity exacerbates ischemia/reperfusion injury through inadvertent downregulation of hypoxia-inducible factor-1? and upregulation of peroxisome proliferator-activated receptor-?.
23372804 2013 Peroxisome proliferator activated receptor-?/hypoxia inducible factor-1? interplay sustains carbonic anhydrase IX and apoliprotein E expression in breast cancer stem cells.
23329136 2013 Fenofibrate inhibits endothelin-1 expression by peroxisome proliferator-activated receptor ?-dependent and independent mechanisms in human endothelial cells.
23295386 2013 Direct transcriptional regulation of human hepatic cytochrome P450 3A4 (CYP3A4) by peroxisome proliferator-activated receptor alpha (PPAR?).
23262340 2013 Gene-gene interactions among PPAR?/?/? polymorphisms for hypertriglyceridemia in Chinese Han population.
23208589 2013 Lack of expression of the proteins GMPR2 and PPAR? are associated with the basal phenotype and patient outcome in breast cancer.
23160450 2013 PPAR-alpha is a therapeutic target for chronic lymphocytic leukemia.
23158661 2012 [Genotype and haplotype analysis of peroxisome proliferators activated receptor ? gene and the risk of essential hypertension].
23144166 2013 Peroxisome proliferator-activated receptor alpha expression changes in human pregnant myometrium.
23141142 2013 Tumour necrosis factor alpha down-regulates the expression of peroxisome proliferator activated receptor alpha (PPAR?) in human hepatocarcinoma HepG2 cells by activation of NF-?B pathway.
23076161 2012 Combined effects of peroxisome proliferator-activated receptor alpha and apolipoprotein E polymorphisms on risk of breast cancer in a Taiwanese population.
22989886 2012 Gemfibrozil and fenofibrate, Food and Drug Administration-approved lipid-lowering drugs, up-regulate tripeptidyl-peptidase 1 in brain cells via peroxisome proliferator-activated receptor ?: implications for late infantile Batten disease therapy.
22983821 2013 The association of ACE, ACTN3 and PPARA gene variants with strength phenotypes in middle school-age children.
22944052 2012 [Effects of PPARD-87T > C and interactions with single nucleotide polymorphisms in PPARA and PPARG on abdominal obesity].
22940187 2012 Fatty liver and anti-oxidant enzyme activities along with peroxisome proliferator-activated receptors ? and ? expressions in the liver of Wilson's disease.
22932900 2012 Activation of peroxisome proliferator-activated receptor ? (PPAR?) suppresses hypoxia-inducible factor-1? (HIF-1?) signaling in cancer cells.
22920733 2013 Investigation of endocannabinoid system genes suggests association between peroxisome proliferator activator receptor-? gene (PPARA) and schizophrenia.
22685582 2012 Design novel dual agonists for treating type-2 diabetes by targeting peroxisome proliferator-activated receptors with core hopping approach.
22654113 2012 The synthetic cannabinoid R(+)WIN55,212-2 augments interferon-? expression via peroxisome proliferator-activated receptor-?.
22649490 2012 Medium chain fatty acids are selective peroxisome proliferator activated receptor (PPAR) ? activators and pan-PPAR partial agonists.
22647601 2012 Peroxisome proliferator-activated receptor (PPAR)? and -? regulate IFN? and IL-17A production by human T cells in a sex-specific way.
22547144 2013 The PPAR alpha gene is associated with triglyceride, low-density cholesterol and inflammation marker response to fenofibrate intervention: the GOLDN study.
22510778 2012 PPARA: a novel genetic determinant of CYP3A4 in vitro and in vivo.
22479552 2012 MicroRNA-141 represses HBV replication by targeting PPARA.
22435679 2012 Effects of L-carnitine against oxidative stress in human hepatocytes: involvement of peroxisome proliferator-activated receptor alpha.
22378291 2011 PPAR?2 gene Pro12Ala and PPAR? gene Leu162Val single nucleotide polymorphisms interact with dietary intake of fat in determination of plasma lipid concentrations.
22349506 2012 PPAR? and PPAR? regulate the nucleoside transporter hENT1.
22336959 2012 Rare PPARA variants and extreme response to fenofibrate in the Genetics of Lipid-Lowering Drugs and Diet Network Study.
22315317 2012 The role of FOXO and PPAR transcription factors in diet-mediated inhibition of PDC activation and carbohydrate oxidation during exercise in humans and the role of pharmacological activation of PDC in overriding these changes.
22266374 2012 Regulation of breast cancer resistant protein by peroxisome proliferator-activated receptor ? in human brain microvessel endothelial cells.
22215653 2012 Plasma mannose-binding lectin is stimulated by PPAR? in humans.
22205725 2012 Peroxisome proliferator-activated receptors modulate proliferation and angiogenesis in human endometrial carcinoma.
22168458 2011 Peroxisome proliferator-activated receptor ? (PPAR?) mRNA expression in human hepatocellular carcinoma tissue and non-cancerous liver tissue.
22092351 2013 Is PPAR? intron 7 G/C polymorphism associated with muscle strength characteristics in nonathletic young men?
22089192 2012 Reduced peroxisome proliferator-activated receptor ? expression is associated with decreased survival and increased tissue bacterial load in sepsis.
22068265 2012 Genetic determinants of Tibetan high-altitude adaptation.
22065208 2012 Interaction of insulin and PPAR-? genes in Alzheimer's disease: the Epistasis Project.
22040870 2012 Effect of interaction between PPARG, PPARA and ADIPOQ gene variants and dietary fatty acids on plasma lipid profile and adiponectin concentration in a large intervention study.
21990353 2011 Inhibition of gluconeogenic genes by calcium-regulated heat-stable protein 1 via repression of peroxisome proliferator-activated receptor ?.
21785974 2012 Association of PPAR polymorphisms with cytokine levels in allergic rhinitis.
21636785 2011 MicroRNA-21 targets peroxisome proliferators-activated receptor-alpha in an autoregulatory loop to modulate flow-induced endothelial inflammation.
21562928 2011 PPAR? is regulated by miR-21 and miR-27b in human liver.
21540177 2011 Human SREBP1c expression in liver is directly regulated by peroxisome proliferator-activated receptor alpha (PPARalpha).
21487230 2011 Effects of peroxisome proliferator-activated receptors, dietary fat intakes and gene-diet interactions on peak particle diameters of low-density lipoproteins.
21443859 2011 Activation of peroxisome proliferator-activated receptor-? enhances fatty acid oxidation in human adipocytes.
21430558 2011 Association of the peroxisome proliferator-activated receptor ? gene L162V polymorphism with stage C heart failure.
21326871 2011 Targeting vascular NADPH oxidase 1 blocks tumor angiogenesis through a PPAR? mediated mechanism.
21304969 2011 CYP1A1 induction in the colon by serum: involvement of the PPAR? pathway and evidence for a new specific human PPRE? site.
21291392 2011 Structural insight into the crucial role of ligand chirality in the activation of PPARs by crystallographic methods.
21282101 2011 ChREBP mediates glucose repression of peroxisome proliferator-activated receptor alpha expression in pancreatic beta-cells.
21245137 2011 Peroxisome proliferator-activated receptor (PPAR) gene profiling uncovers insulin-like growth factor-1 as a PPARalpha target gene in cardioprotection.
21159535 2011 PPAR? polymorphisms as risk factors for dyslipidemia in a Brazilian population.
21125992 2011 Hypoxia-mediated down-regulation of OCTN2 and PPAR? expression in human placentas and in BeWo cells.
21047783 2011 Additional sex comb-like (ASXL) proteins 1 and 2 play opposite roles in adipogenesis via reciprocal regulation of peroxisome proliferator-activated receptor {gamma}.
21030426 2011 Genetic variations in Tibetan populations and high-altitude adaptation at the Himalayas.
20862655 2010 Involvement of PPAR? and PPAR? in apoptosis and proliferation of human hepatocarcinoma HepG2 cells.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20838448 2010 A PPAR? promoter variant impairs ERR-dependent transactivation and decreases mortality after acute coronary ischemia in patients with diabetes.
20837115 2011 Regulation of LPCAT3 by LXR.
20825652 2010 Lack of association between peroxisome proliferator-activated receptors alpha and gamma2 polymorphisms and progressive liver damage in patients with non-alcoholic fatty liver disease: a case control study.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20810571 2010 CXCL9 and CXCL11 chemokines modulation by peroxisome proliferator-activated receptor-alpha agonists secretion in Graves' and normal thyrocytes.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20656057 2010 Citral, a component of lemongrass oil, activates PPAR? and ? and suppresses COX-2 expression.
20653996 2010 Role of the PPARalpha Leu162Val and PPARgamma2 Pro12Ala gene polymorphisms in weight change after 2.5-year follow-up in Czech obese women.
20647061 2011 Mitochondrial biogenesis related endurance genotype score and sports performance in athletes.
20638986 2010 Peroxisome proliferator activated receptor alpha (PPARalpha) and PPAR gamma coactivator (PGC-1alpha) induce carnitine palmitoyltransferase IA (CPT-1A) via independent gene elements.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20620111 2011 Variation in the PPAR? gene in Polish rowers.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20496064 2010 Dynamic correlation networks in human peroxisome proliferator-activated receptor-? nuclear receptor protein.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20466884 2010 Genetic evidence for high-altitude adaptation in Tibet.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20450745 2010 [Relationship between peroxisome proliferator-activated receptor alpha intron 1A/C genetic polymorphism and metabolic syndrome].
20426853 2010 Association and interaction of PPAR-complex gene variants with latent traits of left ventricular diastolic function.
20421589 2010 VLDL hydrolysis by LPL activates PPAR-alpha through generation of unbound fatty acids.
20414453 2010 PPARalpha: energy combustion, hypolipidemia, inflammation and cancer.
20400503 2010 Leukotriene B4 is a physiologically relevant endogenous peroxisome proliferator-activated receptor-alpha agonist.
20399568 2010 Increased expression of peroxisome proliferator-activated receptor (PPAR)-alpha and PPAR-gamma in human atherosclerosis.
20384434 2010 Combining genetic markers and clinical risk factors improves the risk assessment of impaired glucose metabolism.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20238044 2010 PPAR nuclear receptors and altered RPE lipid metabolism in age-related macular degeneration.
20214982 2010 Peroxisome proliferator-activated receptor (PPAR) and vitamin D receptor (VDR) signaling pathways in melanoma cells: promising new therapeutic targets?
20178979 2010 The anti-tumorigenic properties of peroxisomal proliferator-activated receptor alpha are arachidonic acid epoxygenase-mediated.
20070029 2009 Nuclear receptors gene polymorphisms and risk of restenosis and clinical events following coronary stenting.
20045185 2010 Peroxisome proliferator-activated receptors are altered in pathologies of the human placenta: gestational diabetes mellitus, intrauterine growth restriction and preeclampsia.
20044476 2010 Associations of polymorphisms of eight muscle- or metabolism-related genes with performance in Mount Olympus marathon runners.
20016041 2010 Minireview: Won't get fooled again: the nonmetabolic roles of peroxisome proliferator-activated receptors (PPARs) in the heart.
19955185 2010 SUMOylation of human peroxisome proliferator-activated receptor alpha inhibits its trans-activity through the recruitment of the nuclear corepressor NCoR.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19948841 2010 Phospholipase A2-modified low-density lipoprotein activates macrophage peroxisome proliferator-activated receptors.
19937854 2010 PPARalpha L162V polymorphism alters the potential of n-3 fatty acids to increase lipoprotein lipase activity.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19887568 2010 Peroxisome proliferator-activated receptor-alpha control of lipid and glucose metabolism in human white adipocytes.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19828088 2009 Plasma n-3 fatty acid response to an n-3 fatty acid supplement is modulated by apoE epsilon4 but not by the common PPAR-alpha L162V polymorphism in men.
19823578 2009 The epoxygenases CYP2J2 activates the nuclear receptor PPARalpha in vitro and in vivo.
19822141 2010 Association of PPARalpha gene polymorphisms and lipid serum levels in a Brazilian elderly population.
19789836 2010 Steatosis and hepatic expression of genes regulating lipid metabolism in Japanese patients infected with hepatitis C virus.
19780876 2010 Effect of miRNA-10b in regulating cellular steatosis level by targeting PPAR-alpha expression, a novel mechanism for the pathogenesis of NAFLD.
19776627 2008 Effect of the PPAR-Alpha L162V polymorphism on the cardiovascular disease risk factor in response to n-3 polyunsaturated fatty acids.
19748481 2009 Regulation of the human SLC25A20 expression by peroxisome proliferator-activated receptor alpha in human hepatoblastoma cells.
19733654 2009 Enhancement in liver SREBP-1c/PPAR-alpha ratio and steatosis in obese patients: correlations with insulin resistance and n-3 long-chain polyunsaturated fatty acid depletion.
19710929 2009 Comparative analysis of gene regulation by the transcription factor PPARalpha between mouse and human.
19706994 2009 "Hypothesis of seven balances": molecular mechanisms behind alcoholic liver diseases and association with PPARalpha.
19681917 2010 The role of genetic variation in peroxisome proliferator-activated receptors in the polycystic ovary syndrome (PCOS): an original case-control study followed by systematic review and meta-analysis of existing evidence.
19660836 2011 APOE dependent-association of PPAR-? genetic variants with Alzheimer's disease risk.
19653005 2009 The combined impact of metabolic gene polymorphisms on elite endurance athlete status and related phenotypes.
19628794 2009 Shear stress induces synthetic-to-contractile phenotypic modulation in smooth muscle cells via peroxisome proliferator-activated receptor alpha/delta activations by prostacyclin released by sheared endothelial cells.
19622862 2009 Adaptability and selectivity of human peroxisome proliferator-activated receptor (PPAR) pan agonists revealed from crystal structures.
19560472 2009 Clinical factors such as B-type natriuretic peptide link to factor VII, endothelial NO synthase and estrogen receptor alpha polymorphism in elderly women.
19527689 2009 Unlike PPARgamma, PPARalpha or PPARbeta/delta activation does not promote human monocyte differentiation toward alternative macrophages.
19458633 2009 Peroxisome proliferator-activated receptor-alpha is a functional target of p63 in adult human keratinocytes.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19451226 2009 Bcl3 interacts cooperatively with peroxisome proliferator-activated receptor gamma (PPARgamma) coactivator 1alpha to coactivate nuclear receptors estrogen-related receptor alpha and PPARalpha.
19433068 2009 Identification of a functional peroxisome proliferator-activated receptor (PPAR) response element (PPRE) in the human apolipoprotein A-IV gene.
19422653 2010 Do PPARGC1A and PPARalpha polymorphisms influence sprint or endurance phenotypes?
19422369 2009 P633H, a novel dual agonist at peroxisome proliferator-activated receptors alpha and gamma, with different anti-diabetic effects in db/db and KK-Ay mice.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19386311 2009 Peroxisome proliferator-activated receptor-alpha (PPARalpha): at the crossroads of obesity, diabetes and cardiovascular disease.
19367093 2009 Association study between candidate genes and obesity-related phenotypes using a sample of lumberjacks.
19362162 2009 Differential regulation of the human versus the mouse apolipoprotein AV gene by PPARalpha. Implications for the study of pharmaceutical modifiers of hypertriglyceridemia in mice.
19357976 2009 Analysis of PPARalpha-dependent and PPARalpha-independent transcript regulation following fenofibrate treatment of human endothelial cells.
19349176 2009 Aleglitazar, a new, potent, and balanced dual PPARalpha/gamma agonist for the treatment of type II diabetes.
19279199 2009 Preterm and infection-driven preterm labor: the role of peroxisome proliferator-activated receptors and retinoid X receptor.
19263263 2009 Optimization of an enzyme-linked immunosorbent assay to screen ligand of Peroxisome proliferator-activated receptor alpha.
19255064 2009 Vitamin D-related genes, serum vitamin D concentrations and prostate cancer risk.
19254215 2009 [Association of genetic factors with clinical peculiarities of hypertensive disease in patients with burdened familial anamnesis].
19223982 2009 Genetic variability of RXRB, PPARA, and PPARG in Wegener's granulomatosis.
19217440 2009 Influence of cholesteryl ester transfer protein, peroxisome proliferator-activated receptor alpha, apolipoprotein E, and apolipoprotein A-I polymorphisms on high-density lipoprotein cholesterol, apolipoprotein A-I, lipoprotein A-I, and lipoprotein A-I:A-II concentrations: the Prospective Epidemiological Study of Myocardial Infarction study.
19208777 2009 Genetic variation in the ADIPOR2 gene is associated with liver fat content and its surrogate markers in three independent cohorts.
19157507 2009 Expression of the peroxisome proliferator-activated receptors-alpha, -beta, and -gamma in ovarian carcinoma effusions is associated with poor chemoresponse and shorter survival.
19141539 2009 PPARalpha and PPARgamma attenuate HIV-induced dysregulation of tight junction proteins by modulations of matrix metalloproteinase and proteasome activities.
19119483 2008 PPAR-alpha L162V polymorphism in human hepatocellular carcinoma.
19118026 2009 Peroxisome proliferator-activated receptor gamma pathway targeting in carcinogenesis: implications for chemoprevention.
19116277 2009 Scaffold-based discovery of indeglitazar, a PPAR pan-active anti-diabetic agent.
19115207 2009 A-FABP, a candidate progression marker of human transitional cell carcinoma of the bladder, is differentially regulated by PPAR in urothelial cancer cells.
19114110 2009 Chlamydia pneumoniae induces macrophage-derived foam cell formation via PPAR alpha and PPAR gamma-dependent pathways.
19070893 2009 Peroxisome proliferator-activated receptors and retinoid X receptor-alpha in term human gestational tissues: tissue specific and labour-associated changes.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18981151 2008 Pleural mesothelial cells express both BLT2 and PPARalpha and mount an integrated response to pleural leukotriene B4.
18977277 2009 Association of the PPARgamma gene polymorphism Pro12Ala with delayed onset of multiple sclerosis.
18955051 2008 Regulation of the human PDZK1 expression by peroxisome proliferator-activated receptor alpha.
18855529 2008 Interaction between PPARA genotype and beta-blocker treatment influences clinical outcomes following acute coronary syndromes.
18853997 2008 A Val227Ala substitution in the peroxisome proliferator activated receptor alpha (PPAR alpha) gene associated with non-alcoholic fatty liver disease and decreased waist circumference and waist-to-hip ratio.
18848838 2008 Thioredoxin-1 and its natural inhibitor, vitamin D3 up-regulated protein 1, are differentially regulated by PPARalpha in human macrophages.
18797151 2008 PPAR alpha and PPAR delta transactivity and p300 binding activity induced by arachidonic acid in colorectal cancer cell line Caco-2.
18787507 2008 Pharmacological effects of lipid-lowering drugs recapitulate with a larger amplitude the phenotypic effects of common variants within their target genes.
18786524 2008 PPAR-alpha L162V and PGC-1 G482S gene polymorphisms, but not PPAR-gamma P12A, are associated with alcohol consumption in a Spanish Mediterranean population.
18727927 2008 PAR-5359, a well-balanced PPARalpha/gamma dual agonist, exhibits equivalent antidiabetic and hypolipidemic activities in vitro and in vivo.
18726867 2009 The L162V polymorphism of the peroxisome proliferator activated receptor alpha gene (PPARA) is not associated with type 2 diabetes, BMI or body fat composition.
18725353 [PPAR alpha-L162V, frequency and relationship with type 2 diabetes among black Senegalese people].
18713766 2008 Activation of mouse and human peroxisome proliferator-activated receptor alpha by perfluoroalkyl acids of different functional groups and chain lengths.
18680716 2008 The circulating metabolic regulator FGF21 is induced by prolonged fasting and PPARalpha activation in man.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18652775 Cortical expression of peroxisome proliferator-activated receptor-alpha after human brain contusion.
18619963 2008 DNA-binding profiling of human hormone nuclear receptors via fluorescence correlation spectroscopy in a cell-free system.
18586686 2008 Peroxisome proliferator-activated receptor-alpha (PPARA) genetic polymorphisms and breast cancer risk: a Long Island ancillary study.
18549840 2008 Cholesterol ester transfer protein, interleukin-8, peroxisome proliferator activator receptor alpha, and Toll-like receptor 4 genetic variations and risk of incident nonfatal myocardial infarction and ischemic stroke.
18541586 2008 Peroxisome proliferator-activated receptor [alpha] genetic variation interacts with n-6 and long-chain n-3 fatty acid intake to affect total cholesterol and LDL-cholesterol concentrations in the Atherosclerosis Risk in Communities Study.
18518955 2008 Activation of peroxisome proliferator-activated receptor alpha in human peripheral blood mononuclear cells reveals an individual gene expression profile response.
18440986 2008 Overexpression of human truncated peroxisome proliferator-activated receptor alpha induces apoptosis in HL-1 cardiomyocytes.
18398047 2008 Single nucleotide polymorphisms in obesity-related genes and the risk of esophageal cancers.
18394939 2008 Molecular mechanics and molecular orbital simulations on specific interactions between peroxisome proliferator-activated receptor PPARalpha and plasticizer.
18388689 2008 Single gene contributions: genetic variants of peroxisome proliferator-activated receptor (isoforms alpha, beta/delta and gamma) and mechanisms of dyslipidemias.
18336366 2008 Association between PPARalpha gene polymorphisms and myocardial infarction.
18313368 2008 Molecular mechanism of PPAR in the regulation of age-related inflammation.
18292238 2008 A natural polymorphism in peroxisome proliferator-activated receptor-alpha hinge region attenuates transcription due to defective release of nuclear receptor corepressor from chromatin.
18268046 2008 Selective activation of peroxisome proliferator-activated receptor (PPAR)alpha and PPAR gamma induces neoangiogenesis through a vascular endothelial growth factor-dependent mechanism.
18255343 Inhibition of vascular inflammation by dehydroepiandrosterone sulfate in human aortic endothelial cells: roles of PPARalpha and NF-kappaB.
18245819 2008 Dual mechanisms for the fibrate-mediated repression of proprotein convertase subtilisin/kexin type 9.
18219093 2008 Protective effect of R allele of PON1 gene on the coronary artery disease in the presence of specific genetic background.
18184928 2008 Liver-specific peroxisome proliferator-activated receptor alpha target gene regulation by the angiotensin type 1 receptor blocker telmisartan.
18182682 2008 Thematic review series: skin lipids. Peroxisome proliferator-activated receptors and liver X receptors in epidermal biology.
18172578 2008 PPARalpha/gamma expression and activity in mouse and human melanocytes and melanoma cells.
18061194 2008 Polymorphisms in the peroxisome proliferator activated receptor alpha gene are associated with levels of apolipoprotein CIII and triglyceride in African-Americans but not Caucasians.
18004978 2008 Homocysteine-mediated PPARalpha,gamma DNA methylation and its potential pathogenic mechanism in monocytes.
18003597 2008 PPARalpha and PPARbeta are differentially affected by ethanol and the ethanol metabolite acetaldehyde in the MCF-7 breast cancer cell line.
17998026 2007 Decreased peroxisome proliferator-activated receptor alpha gene expression is associated with dyslipidemia in a rat model of chronic renal failure.
17991667 2007 Fasting induces changes in peripheral blood mononuclear cell gene expression profiles related to increases in fatty acid beta-oxidation: functional role of peroxisome proliferator activated receptor alpha in human peripheral blood mononuclear cells.
17963696 2007 PPARalpha transcriptionally induces AhR expression in Caco-2, but represses AhR pro-inflammatory effects.
17962186 2007 Induction of nuclear translocation of constitutive androstane receptor by peroxisome proliferator-activated receptor alpha synthetic ligands in mouse liver.
17951966 2007 Differential effects of aging, drinking and exercise on serum cholesterol levels dependent on the PPARA-V227A polymorphism.
17926914 2007 [Association of regulatory genes polymorphisms with aerobic and anaerobic performance of athletes].
17850927 2009 The PPAR-alpha gene in Alzheimer's disease: lack of replication of earlier association.
17705849 2007 PPARalpha L162V underlies variation in serum triglycerides and subcutaneous fat volume in young males.
17700210 2007 Genetic polymorphism in the pregnancy-associated plasma protein-A associated with acute myocardial infarction.
17655842 2007 Delta5 desaturase mRNA levels are increased by simvastatin via SREBP-1 at early stages, not via PPARalpha, in THP-1 cells.
17646210 2007 The transcriptional coactivator peroxisome proliferator activated receptor (PPAR)gamma coactivator-1 alpha and the nuclear receptor PPAR alpha control the expression of glycerol kinase and metabolism genes independently of PPAR gamma activation in human white adipocytes.
17616429 2007 Interleukin-6 inhibits human peroxisome proliferator activated receptor alpha gene expression via CCAAT/enhancer-binding proteins in hepatocytes.
17608096 2007 Synergistic effect between polymorphisms of PPARA and ABCA1 genes on the premature coronary artery disease.
17492134 2007 Ligands of peroxisome proliferator-activated receptor inhibit homocysteine-induced DNA methylation of inducible nitric oxide synthase gene.
17436029 2007 Epidermal lipoxygenase products of the hepoxilin pathway selectively activate the nuclear receptor PPARalpha.
17431031 2007 Cytochrome P450 eicosanoids are activators of peroxisome proliferator-activated receptor alpha.
17363837 2007 Peroxisome proliferator-activated receptor alpha polymorphisms and postprandial lipemia in healthy men.
17363697 2007 CD36 deficiency rescues lipotoxic cardiomyopathy.
17356846 2007 Roles of PPARs on regulating myocardial energy and lipid homeostasis.
17355223 2007 PPARalpha and AP-2alpha regulate bombesin receptor subtype 3 expression in ozone-stressed bronchial epithelial cells.
17342071 2007 Genetic epistasis in the VLDL catabolic pathway is associated with deleterious variations on triglyceridemia in obese subjects.
17331954 2007 Hepatocyte-restricted constitutive activation of PPAR alpha induces hepatoproliferation but not hepatocarcinogenesis.
17317762 2007 Single nucleotide polymorphisms of the peroxisome proliferator-activated receptor-alpha gene (PPARA) influence the conversion from impaired glucose tolerance to type 2 diabetes: the STOP-NIDDM trial.
17300045 2006 [The association of gene polymorphisms with the muscle fiber type composition].
17272748 2007 High frequency of a retinoid X receptor gamma gene variant in familial combined hyperlipidemia that associates with atherogenic dyslipidemia.
17244467 2007 [The association of Val227Ala polymorphism of the peroxisome proliferator activated receptor alpha (PPAR alpha) gene with non-alcoholic fatty liver disease].
17243659 2007 Substituted 2-[(4-aminomethyl)phenoxy]-2-methylpropionic acid PPARalpha agonists. 1. Discovery of a novel series of potent HDLc raising agents.
17200111 2007 Combined simulation and mutagenesis analyses reveal the involvement of key residues for peroxisome proliferator-activated receptor alpha helix 12 dynamic behavior.
17195188 2007 Comparison of the expression patterns of newly identified zebrafish retinoic acid and retinoid X receptors.
17184146 2007 Influence of PPAR-alpha agonist fenofibrate on insulin sensitivity and selected adipose tissue-derived hormones in obese women with type 2 diabetes.
17181634 2007 Early cutaneous gene transcription changes in adult atopic dermatitis and potential clinical implications.
17157019 2007 Design and synthesis of oxime ethers of alpha-acyl-beta-phenylpropanoic acids as PPAR dual agonists.
17150915 2006 Analysis of PPAR alpha function in human kidney cell line using siRNA.
17129741 2007 Relationships between the functional PPARalpha Leu162Val polymorphism and obesity, type 2 diabetes, dyslipidaemia, and related quantitative traits in studies of 5799 middle-aged white people.
17084382 2006 Cholesteryl ester hydroperoxides increase macrophage CD36 gene expression via PPARalpha.
17008383 2007 Asymmetric cleavage of beta-carotene yields a transcriptional repressor of retinoid X receptor and peroxisome proliferator-activated receptor responses.
17001213 2006 Relationship of classical and non-classical risk factors with genetic variants relevant to coronary heart disease.
16956579 2006 The human myeloperoxidase gene is regulated by LXR and PPARalpha ligands.
16875506 2006 Peroxisome proliferator-activated receptor alpha (PPAR alpha) down-regulation in cystic fibrosis lymphocytes.
16847426 2006 Association of V227A PPARalpha polymorphism with altered serum biochemistry and alcohol drinking in Japanese men.
16822823 2006 The Pro12Ala variant of the PPARG gene is a risk factor for peroxisome proliferator-activated receptor-gamma/alpha agonist-induced edema in type 2 diabetic patients.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16763159 2006 Consistent effects of genes involved in reverse cholesterol transport on plasma lipid and apolipoprotein levels in CARDIA participants.
16652134 2006 Association of peroxisome proliferator-activated receptor delta +294T/C with body mass index and interaction with peroxisome proliferator-activated receptor alpha L162V.
16637234 2006 Gly395Arg polymorphism of PPARalpha gene was not detected in Japanese population of 729 individuals.
16630553 2006 Gene polymorphisms in the Quebec population: a risk to develop hypertriglyceridemia.
16554032 2006 PRIC320, a transcription coactivator, isolated from peroxisome proliferator-binding protein complex.
16511589 2006 Sorting out the roles of PPAR alpha in energy metabolism and vascular homeostasis.
16506057 2006 PPARalpha gene variation and physical performance in Russian athletes.
16492688 2006 Thioredoxin-mediated negative autoregulation of peroxisome proliferator-activated receptor alpha transcriptional activity.
16416313 2006 Variation in the lipoprotein lipase gene influences exercise-induced left ventricular growth.
16377806 2006 Differential susceptibility of mice humanized for peroxisome proliferator-activated receptor alpha to Wy-14,643-induced liver tumorigenesis.
16309557 2005 Association of common variation in the PPARA gene with incident myocardial infarction in individuals with type 2 diabetes: a Go-DARTS study.
16297361 2005 Peroxisome proliferator-activated receptor alpha L162V polymorphism in nonalcoholic steatohepatitis and genotype 1 hepatitis C virus-related liver steatosis.
16288986 2005 PPARalpha activation upregulates nephrin expression in human embryonic kidney epithelial cells and podocytes by a dual mechanism.
16288935 2006 The V227A polymorphism at the PPARA locus is associated with serum lipid concentrations and modulates the association between dietary polyunsaturated fatty acid intake and serum high density lipoprotein concentrations in Chinese women.
16285997 2005 The peroxisome proliferator-activated receptor delta +294T/C polymorphism in relation to lipoprotein metabolism in patients with diabetes mellitus type 2 and in non-diabetic controls.
16275545 2005 The dependence of serum interleukin-6 level on PPAR-alpha polymorphism in men with coronary atherosclerosis.
16271724 2005 An intronic peroxisome proliferator-activated receptor-binding sequence mediates fatty acid induction of the human carnitine palmitoyltransferase 1A.
16239970 2005 PPAR alpha inhibits vascular smooth muscle cell proliferation underlying intimal hyperplasia by inducing the tumor suppressor p16INK4a.
16226051 2006 Peroxisome proliferator-activated receptor alpha expression is regulated by estrogen receptor alpha and modulates the response of MCF-7 cells to sodium butyrate.
16221474 2006 The L162V polymorphism at the peroxisome proliferator activated receptor alpha locus modulates the risk of cardiovascular events associated with insulin resistance and diabetes mellitus: the Veterans Affairs HDL Intervention Trial (VA-HIT).
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16162941 2005 Peroxisome proliferator-activated receptor alpha controls cellular cholesterol trafficking in macrophages.
16043164 2005 Contemporaneous carrier-state of two or three "proatherosclerotic" variants of APOE, ICAM1, PPARA and PAI-1 genes differentiate CAD patients from healthy individuals.
15940190 2005 [Clinical genetic determinants of carbohydrate metabolism disturbances in patients with hypertension and excessive weight].
15935279 2005 The conserved residue Phe273(282) of PPARalpha(gamma), beyond the ligand-binding site, functions in binding affinity through solvation effect.
15888456 2005 Structural determinants of the agonist-independent association of human peroxisome proliferator-activated receptors with coactivators.
15811118 2005 Peroxisome proliferator-activated receptors in squamous cell carcinoma and its precursors.
15797250 2005 Conditional regulation of the human CYP4X1 and CYP4Z1 genes.
15759454 2005 [Clinicogenetic aspects of carbohydrate metabolism disorders and efficacy of their correction with moxonidine and metformine in patients with arterial hypertension].
15735069 2005 Polyunsaturated fatty acids interact with the PPARA-L162V polymorphism to affect plasma triglyceride and apolipoprotein C-III concentrations in the Framingham Heart Study.
15699916 2004 [Genetic Predictors of Unfavorable Course in High Risk Patients With Ischemic Heart Disease. Data of Follow-up for Two Years.].
15699244 2005 The peroxisome proliferator-activated receptor alpha Leu162Val polymorphism influences the metabolic response to a dietary intervention altering fatty acid proportions in healthy men.
15685545 2005 Impaired expression of the peroxisome proliferator-activated receptor alpha during hepatitis C virus infection.
15677519 2005 Peroxisome proliferator-activated receptor alpha gene variation influences age of onset and progression of type 2 diabetes.
15642120 2005 Prolonged treatment of genetically obese mice with conjugated linoleic acid improves glucose tolerance and lowers plasma insulin concentration: possible involvement of PPAR activation.
15608561 2004 Response to micronized fenofibrate treatment is associated with the peroxisome-proliferator-activated receptors alpha G/C intron7 polymorphism in subjects with type 2 diabetes.
15549499 2004 Population prevalence of APOE, APOC3 and PPAR-alpha mutations associated to hypertriglyceridemia in French Canadians.
15539630 2004 Peroxisome proliferator-activated receptor alpha induces NADPH oxidase activity in macrophages, leading to the generation of LDL with PPAR-alpha activation properties.
15521013 2004 Evidence for a new human CYP1A1 regulation pathway involving PPAR-alpha and 2 PPRE sites.
15500444 2005 CLOCK is involved in the circadian transactivation of peroxisome-proliferator-activated receptor alpha (PPARalpha) in mice.
15497675 2004 Peroxisome proliferator-activated receptor (PPAR)-alpha: a pharmacological target with a promising future.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15456881 2004 Estrogen-related receptor alpha directs peroxisome proliferator-activated receptor alpha signaling in the transcriptional control of energy metabolism in cardiac and skeletal muscle.
15318936 2004 A retinoid X receptor (RXR)-selective retinoid reveals that RXR-alpha is potentially a therapeutic target in breast cancer cell lines, and that it potentiates antiproliferative and apoptotic responses to peroxisome proliferator-activated receptor ligands.
15309680 2004 Association between the PPARalpha-L162V polymorphism and components of the metabolic syndrome.
15258199 2004 Bezafibrate stimulates canalicular localization of NBD-labeled PC in HepG2 cells by PPARalpha-mediated redistribution of ABCB4.
15231516 2004 Oxidized omega-3 fatty acids inhibit NF-kappaB activation via a PPARalpha-dependent pathway.
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
15199365 2004 Association between the PPARalpha L162V polymorphism, plasma lipoprotein levels, and atherosclerotic disease in patients with diabetes mellitus type 2 and in nondiabetic controls.
15196699 2004 Genistein enhances expression of genes involved in fatty acid catabolism through activation of PPARalpha.
15131257 2004 The protein kinase C signaling pathway regulates a molecular switch between transactivation and transrepression activity of the peroxisome proliferator-activated receptor alpha.
15128052 2004 Effects of PPARalpha, gamma and delta haplotypes on plasma levels of lipids, severity and progression of coronary atherosclerosis and response to statin therapy in the lipoprotein coronary atherosclerosis study.
15111510 2004 Complex haplotypes of the PGC-1alpha gene are associated with carbohydrate metabolism and type 2 diabetes.
15083308 2004 Variations in the genes encoding the peroxisome proliferator-activated receptors alpha and gamma in psoriasis.
15067378 2004 Effect of peroxisome proliferator-activated receptor alpha on human angiotensinogen promoter.
15051727 2004 Identification of the CREB-binding protein/p300-interacting protein CITED2 as a peroxisome proliferator-activated receptor alpha coregulator.
15001550 2004 Transcriptional cofactors exhibit differential preference toward peroxisome proliferator-activated receptors alpha and delta in uterine cells.
15001458 2004 Modulation of PPARalpha expression and inflammatory interleukin-6 production by chronic glucose increases monocyte/endothelial adhesion.
14999402 2004 Peroxisome proliferator-activated receptor alpha target genes.
14764586 2004 Global suppression of IL-6-induced acute phase response gene expression after chronic in vivo treatment with the peroxisome proliferator-activated receptor-alpha activator fenofibrate.
14730379 2004 Multifactor-dimensionality reduction shows a two-locus interaction associated with Type 2 diabetes mellitus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14677049 2003 Combined effects of PPARgamma2 P12A and PPARalpha L162V polymorphisms on glucose and insulin homeostasis: the Québec Family Study.
14671555 2003 [Genetic predictors of left ventricular hypertrophy: do polymorphisms of peroxisome proliferator activated nuclear receptor genes play any role?].
14641801 2003 Peroxisome proliferator activated receptor delta genotype in relation to cardiovascular risk factors and risk of coronary heart disease in hypercholesterolaemic men.
14633846 2003 Endurance training in humans leads to fiber type-specific increases in levels of peroxisome proliferator-activated receptor-gamma coactivator-1 and peroxisome proliferator-activated receptor-alpha in skeletal muscle.
14523052 2004 PPARalpha controls the intracellular coenzyme A concentration via regulation of PANK1alpha gene expression.
14519597 2004 Human skeletal muscle PPARalpha expression correlates with fat metabolism gene expression but not BMI or insulin sensitivity.
14515181 2003 Induction of plasminogen activator inhibitor I by the PPARalpha ligand, Wy-14,643, is dependent on ERK1/2 signaling pathway.
12955147 2003 Oleylethanolamide regulates feeding and body weight through activation of the nuclear receptor PPAR-alpha.
12938026 2003 Polymorphism in the peroxisome proliferator-activated receptor alpha gene influences the risk for Alzheimer's disease.
12932225 2003 Peroxisome proliferator-activated receptors in cutaneous biology.
12914524 2003 Functional interference between estrogen-related receptor alpha and peroxisome proliferator-activated receptor alpha/9-cis-retinoic acid receptor alpha heterodimer complex in the nuclear receptor response element-1 of the medium chain acyl-coenzyme A dehydrogenase gene.
12897377 2003 Induction and repression of peroxisome proliferator-activated receptor alpha transcription by coregulator ARA70.
12855749 2003 The peroxisome proliferator-activated receptor alpha L162V mutation is associated with reduced adiposity.
12847522 2003 Dexamethasone induction of hypertension and diabetes is PPAR-alpha dependent in LDL receptor-null mice.
12835617 2003 Evidence for an association between the Leu162Val polymorphism of the PPARalpha gene and decreased fasting serum triglyceride levels in glucose tolerant subjects.
12810707 2003 Peroxisome proliferator-activated receptor alpha induces hepatic expression of the human bile acid glucuronidating UDP-glucuronosyltransferase 2B4 enzyme.
12745064 2003 Molecular characterisation of six alternatively spliced variants and a novel promoter in human peroxisome proliferator-activated receptor alpha.
12709436 2003 The human apolipoprotein AV gene is regulated by peroxisome proliferator-activated receptor-alpha and contains a novel farnesoid X-activated receptor response element.
12700342 2003 PPAR(alpha) and PPAR(gamma) activators suppress the monocyte-macrophage apoB-48 receptor.
12655356 2003 Peroxisome proliferator-activated receptor alpha is downregulated in the failing human heart.
12615366 2003 Differential and bi-directional regulation between TR2/TR4 orphan nuclear receptors and a specific ligand mediated-peroxisome proliferator-activated receptor alpha in human HaCaT keratinocytes.
12594814 2003 Expression of peroxisome proliferator-activated receptors (PPARs) in human urinary bladder carcinoma and growth inhibition by its agonists.
12594295 2003 Activation of peroxisome proliferator-activated receptors in human airway smooth muscle cells has a superior anti-inflammatory profile to corticosteroids: relevance for chronic obstructive pulmonary disease therapy.
12554753 2003 Bile acids induce the expression of the human peroxisome proliferator-activated receptor alpha gene via activation of the farnesoid X receptor.
12544508 2003 A microarray minisequencing system for pharmacogenetic profiling of antihypertensive drug response.
12482853 2003 Evidence that peroxisome proliferator-activated receptor alpha is complexed with the 90-kDa heat shock protein and the hepatitis virus B X-associated protein 2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12468272 2002 Identification of the PPARA locus on chromosome 22q13.3 as a modifier gene in familial combined hyperlipidemia.
12408750 2003 Control of human carnitine palmitoyltransferase II gene transcription by peroxisome proliferator-activated receptor through a partially conserved peroxisome proliferator-responsive element.
12395215 2002 Polymorphisms in candidate obesity genes and their interaction with dietary intake of n-6 polyunsaturated fatty acids affect obesity risk in a sub-sample of the EPIC-Heidelberg cohort.
12208475 2002 Peroxisome proliferator-activated receptor alpha and gamma agonists upregulate human macrophage lipoprotein lipase expression.
12203367 2002 Peroxisome proliferator-activated receptor alpha in the human breast cancer cell lines MCF-7 and MDA-MB-231.
12189208 2002 Identification of a transcriptionally active peroxisome proliferator-activated receptor alpha -interacting cofactor complex in rat liver and characterization of PRIC285 as a coactivator.
12163133 2002 Ligand and coactivator recruitment preferences of peroxisome proliferator activated receptor alpha.
12161442 2002 Fatty acid regulation of liver X receptors (LXR) and peroxisome proliferator-activated receptor alpha (PPARalpha ) in HEK293 cells.
12118038 2002 Fatty acid homeostasis and induction of lipid regulatory genes in skeletal muscles of peroxisome proliferator-activated receptor (PPAR) alpha knock-out mice. Evidence for compensatory regulation by PPAR delta.
12118000 2002 Peroxisome proliferator-activated receptor alpha (PPARalpha ) turnover by the ubiquitin-proteasome system controls the ligand-induced expression level of its target genes.
12055195 2002 Human apical sodium-dependent bile salt transporter gene (SLC10A2) is regulated by the peroxisome proliferator-activated receptor alpha.
12048138 2002 Genetic determinants of the response to bezafibrate treatment in the lower extremity arterial disease event reduction (LEADER) trial.
12042669 2002 Effect of apolipoprotein E, peroxisome proliferator-activated receptor alpha and lipoprotein lipase gene mutations on the ability of fenofibrate to improve lipid profiles and reach clinical guideline targets among hypertriglyceridemic patients.
12039952 2002 Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha.
12023905 2002 Interaction of oestrogen and peroxisome proliferator-activated receptors with apolipoprotein(a) gene enhancers.
12006394 2002 Association between the PPARA L162V polymorphism and plasma lipid levels: the Framingham Offspring Study.
11981036 2002 Characterization of the human PPARalpha promoter: identification of a functional nuclear receptor response element.
11980898 2002 Differential regulation of vascular endothelial growth factor expression by peroxisome proliferator-activated receptors in bladder cancer cells.
11940516 2002 Mechanism of constrictive vascular remodeling by homocysteine: role of PPAR.
11934839 2002 PPAR activators as antiinflammatory mediators in human T lymphocytes: implications for atherosclerosis and transplantation-associated arteriosclerosis.
11923467 2002 Selective intranuclear redistribution of PPAR isoforms by RXR alpha.
11915042 2002 Interaction of hepatitis C virus core protein with retinoid X receptor alpha modulates its transcriptional activity.
11914252 2002 Peroxisome proliferator-activated receptor alpha gene variants influence progression of coronary atherosclerosis and risk of coronary artery disease.
11897821 2002 A Val227Ala polymorphism in the peroxisome proliferator activated receptor alpha (PPARalpha) gene is associated with variations in serum lipid levels.
11897617 2002 85-kDa cPLA(2) plays a critical role in PPAR-mediated gene transcription in human hepatoma cells.
11864924 2002 Peroxisome proliferator--activated receptor alpha gene regulates left ventricular growth in response to exercise and hypertension.
11852057 2002 Peroxisome proliferator-activated receptor (PPAR) agonists decrease lipoprotein lipase secretion and glycated LDL uptake by human macrophages.
11845213 2002 Structural basis for antagonist-mediated recruitment of nuclear co-repressors by PPARalpha.
11840500 2002 Mutation analysis of the retinoid X receptor beta, nuclear-related receptor 1, and peroxisome proliferator-activated receptor alpha genes in schizophrenia and alcohol dependence: possible haplotype association of nuclear-related receptor 1 gene to alcohol dependence.
11818483 2002 The mechanisms of action of PPARs.
11698662 2001 Structural determinants of ligand binding selectivity between the peroxisome proliferator-activated receptors.
11668221 2001 Variation at position 162 of peroxisome proliferator-activated receptor alpha does not influence the effect of fibrates on cholesterol or triacylglycerol concentrations in hyperlipidaemic subjects.
11587644 2001 Structure of the PPARalpha and -gamma ligand binding domain in complex with AZ 242; ligand selectivity and agonist activation in the PPAR family.
11466580 2001 Association between polymorphisms in candidate genes and morbid obesity.
11409711 2001 A polymorphism, L162V, in the peroxisome proliferator-activated receptor alpha (PPARalpha) gene is associated with lower body mass index in patients with non-insulin-dependent diabetes mellitus.
11375929 2001 Diverse transcriptional initiation revealed by fine, large-scale mapping of mRNA start sites.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
11226238 2001 Fatty acids and hypolipidemic drugs regulate peroxisome proliferator-activated receptors alpha - and gamma-mediated gene expression via liver fatty acid binding protein: a signaling path to the nucleus.
11119019 2000 Mutation screening of the PPARalpha gene in type 2 diabetes associated with coronary heart disease.
10903152 2000 The pro-apoptotic protein death-associated protein 3 (DAP3) interacts with the glucocorticoid receptor and affects the receptor function.
10872826 2000 Gadd45 family proteins are coactivators of nuclear hormone receptors.
10862523 2000 The human peroxisome proliferator-activated receptor alpha gene: identification and functional characterization of two natural allelic variants.
10860941 2000 Differences in the formation of PPARalpha-RXR/acoPPRE complexes between responsive and nonresponsive species upon fibrate administration.
10786636 2000 Nuclear receptor binding factor-2 (NRBF-2), a possible gene activator protein interacting with nuclear hormone receptors.
10681503 2000 Cloning and characterization of RAP250, a novel nuclear receptor coactivator.
10669761 2000 The coactivator PGC-1 cooperates with peroxisome proliferator-activated receptor alpha in transcriptional control of nuclear genes encoding mitochondrial fatty acid oxidation enzymes.
10591208 1999 The DNA sequence of human chromosome 22.
10542237 1999 Peroxisome proliferator-activated receptor alpha negatively regulates the vascular inflammatory gene response by negative cross-talk with transcription factors NF-kappaB and AP-1.
10403814 1999 Evidence for direct binding of fatty acids and eicosanoids to human peroxisome proliferators-activated receptor alpha.
10377439 1999 A critical role for the peroxisome proliferator-activated receptor alpha (PPARalpha) in the cellular fasting response: the PPARalpha-null mouse as a model of fatty acid oxidation disorders.
10336495 1999 Identification of nuclear receptor corepressor as a peroxisome proliferator-activated receptor alpha interacting protein.
10195690 1999 Conserved amino acids in the ligand-binding and tau(i) domains of the peroxisome proliferator-activated receptor alpha are necessary for heterodimerization with RXR.
10187842 1999 Regulation of the transcriptional activity of the peroxisome proliferator-activated receptor alpha by phosphorylation of a ligand-independent trans-activating domain.
10022764 1998 Receptor-interacting protein 140 interacts with and inhibits transactivation by, peroxisome proliferator-activated receptor alpha and liver-X-receptor alpha.
9915808 1999 Phytanic acid activates the peroxisome proliferator-activated receptor alpha (PPARalpha) in sterol carrier protein 2-/ sterol carrier protein x-deficient mice.
9795230 1998 Nuclear receptor binding factor-1 (NRBF-1), a protein interacting with a wide spectrum of nuclear hormone receptors.
9792666 1998 Peroxisome proliferator-activated receptor alpha-isoform deficiency leads to progressive dyslipidemia with sexually dimorphic obesity and steatosis.
9748239 1998 The nuclear receptors peroxisome proliferator-activated receptor alpha and Rev-erbalpha mediate the species-specific regulation of apolipoprotein A-I expression by fibrates.
9748221 1998 Activation of proliferator-activated receptors alpha and gamma induces apoptosis of human monocyte-derived macrophages.
9653119 1998 The TRAP220 component of a thyroid hormone receptor- associated protein (TRAP) coactivator complex interacts directly with nuclear receptors in a ligand-dependent fashion.
9627117 1998 Characterization of Brx, a novel Dbl family member that modulates estrogen receptor action.
9626662 1998 A regulatory role for RIP140 in nuclear receptor activation.
9610365 1998 Expression of peroxisome proliferator-activated receptor alpha (PPAR alpha) in primary cultures of human vascular endothelial cells.
9556573 1998 Regulation of peroxisome proliferator-activated receptor alpha-induced transactivation by the nuclear orphan receptor TAK1/TR4.
9407140 1997 p300 functions as a coactivator for the peroxisome proliferator-activated receptor alpha.
9238002 1997 RAC3, a steroid/nuclear receptor-associated coactivator that is related to SRC-1 and TIF2.
9113987 1997 Fatty acids and eicosanoids regulate gene expression through direct interactions with peroxisome proliferator-activated receptors alpha and gamma.
8993548 1996 Peroxisome proliferator-activated receptors: structures and function.
8910358 1996 Cloning and identification of rat deoxyuridine triphosphatase as an inhibitor of peroxisome proliferator-activated receptor alpha.
8621574 1996 The orphan nuclear hormone receptor LXR alpha interacts with the peroxisome proliferator-activated receptor and inhibits peroxisome proliferator signaling.
7981125 1994 Human and rat peroxisome proliferator activated receptors (PPARs) demonstrate similar tissue distribution but different responsiveness to PPAR activators.
7684926 1993 cDNA cloning, chromosomal mapping, and functional characterization of the human peroxisome proliferator activated receptor.
7629123 1995 Peroxisome proliferator-activated receptor mediates cross-talk with thyroid hormone receptor by competition for retinoid X receptor. Possible role of a leucine zipper-like heptad repeat.