Property Summary

NCBI Gene PubMed Count 22
PubMed Score 311.91
PubTator Score 238.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.300 5.6e-04
cutaneous lupus erythematosus -2.200 4.1e-04
osteosarcoma 1.867 7.6e-07
medulloblastoma, large-cell 1.100 5.6e-04
intraductal papillary-mucinous adenoma (... 1.900 6.3e-03
intraductal papillary-mucinous carcinoma... 2.100 4.6e-02
intraductal papillary-mucinous neoplasm ... 4.100 1.3e-04
active Crohn's disease -1.256 4.8e-03
pancreatic cancer 1.400 8.4e-04
interstitial cystitis -1.400 2.7e-03
spina bifida -1.939 2.3e-02
Breast cancer -1.300 3.4e-05
ovarian cancer 2.100 2.9e-03

Gene RIF (13)

PMID Text
25178105 Analysis of the transcription factor POU2F3 revealed a DOPr-mediated extracellular signal-regulated kinase (ERK)-dependent downregulation of this factorThe delta-opioid receptor affects epidermal homeostasis
24954220 These results suggested that the epidermal differentiation signaling pathway, involving kinase and phosphatase activation, may regulate the NLS activity of Skn1a in keratinocytes
24428937 Skn-1a is expressed in a minority of Mash1-positive olfactory progenitor cells and a majority of Trpm5-expressing microvillous cells in the main olfactory epithelium.
21074976 It is possible that Skn-1a and the related isoforms have different functions in keratinocyte differentiation and proliferation.
20888799 the antagonistic effects of Skn-1a and p63 on keratin promoter transactivation is probably through competition for overlapping binding sites on target gene promoter or through an indirect interaction.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18479461 Skn-1a enhanced the transient replication of a plasmid containing the HPV16 replication origin in HEK293 cells when co-transfected with a plasmid expressing E1 and E2.
17989732 splice variant induced in keratinocytes by high calcium
17195013 Our results suggest that Tst-1 and Skn-1a regulate expression of MMPs in keratinocytes and effect both the expression and activation of these proteolytic enzymes.
16607278 POU2F3 in cervical cancer cells may be CC-related tumor suppressor genes, which are disrupted by both epigenetic and genetic mechanisms.
16005513 Pla-1 protein binds to a POU-consensus DNA sequence in the human placental lactogen-3 (PL-3) promoter and it is capable of trans-activating its transcription up to 18-fold.
15077167 These results suggest that the expression of hSkn-1a represses the growth of the cervical cancer cells through the partial resumption of the differentiation pathway followed by slow suppression of cell replication and apoptosis.
12624109 the human Skn-1 locus encodes multifunctional protein isotypes, subjected to biochemical cross-talk, which are likely to play a major role in the fine-tuning of keratinocyte terminal differentiation

AA Sequence

MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPA      1 - 70
MMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQGLQPNLLPFPQQQSGLLLPQ     71 - 140
TGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSGGADEPSDLEELEKFAKTFKQRRIKLGFTQG    141 - 210
DVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGR    211 - 280
KRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPIKPP    281 - 350
VYNSRLVSPSGSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSF    351 - 420
NSSGSWYRWNHSTYLH                                                          421 - 436
//

Text Mined References (24)

PMID Year Title
25178105 2015 The ?-opioid receptor affects epidermal homeostasis via ERK-dependent inhibition of transcription factor POU2F3.
24954220 2014 Functional analysis of the nuclear localization signal of the POU transcription factor Skn?1a in epidermal keratinocytes.
24428937 2014 Skn-1a/Pou2f3 is required for the generation of Trpm5-expressing microvillous cells in the mouse main olfactory epithelium.
21074976 2010 Relation between the expression levels of the POU transcription factors Skn-1a and Skn-1n and keratinocyte differentiation.
20888799 2010 Skn-1a/Oct-11 and ?Np63? exert antagonizing effects on human keratin expression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18479461 2008 Transcription factor human Skn-1a enhances replication of human papillomavirus DNA through the direct binding to two sites near the viral replication origin.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17989732 2008 Identification of Skn-1n, a splice variant induced by high calcium concentration and specifically expressed in normal human keratinocytes.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
17195013 2007 Matrix metalloproteinase-19 expression in keratinocytes is repressed by transcription factors Tst-1 and Skn-1a: implications for keratinocyte differentiation.
16607278 2006 Aberrant promoter methylation and silencing of the POU2F3 gene in cervical cancer.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16005513 The transcription factor PLA-1/SKN-1A is expressed in human placenta and regulates the placental lactogen-3 gene expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15077167 2004 Keratinocyte-specific POU transcription factor hSkn-1a represses the growth of cervical cancer cell lines.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645924 2003 A promoter within the E6 ORF of human papillomavirus type 16 contributes to the expression of the E7 oncoprotein from a monocistronic mRNA.
12624109 2003 Distinct functional interactions of human Skn-1 isoforms with Ese-1 during keratinocyte terminal differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11429405 2001 The POU domain factor Skin-1a represses the keratin 14 promoter independent of DNA binding. A possible role for interactions between Skn-1a and CREB-binding protein/p300.
10473598 1999 Characterization of the regulatory domains of the human skn-1a/Epoc-1/Oct-11 POU transcription factor.
9242494 1997 Functions of the POU domain genes Skn-1a/i and Tst-1/Oct-6/SCIP in epidermal differentiation.
8441607 1993 Cloning, chromosomal localization and expression pattern of the POU domain gene Oct-11.