Property Summary

NCBI Gene PubMed Count 7
PubMed Score 29.35

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BT43 B1MVG5 RNA polymerase III subunit C7-like
Symbols RPC32HOM
flj32422

Gene

PDB

5AFQ  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

AA Sequence

MASRGGGRGRGRGQLTFNVEAVGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGA      1 - 70
MRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPRELKIRVRKLQKERITILLPKRPPKT     71 - 140
TEDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEEEEEEYDEEEHEEETDYIMSYFDNGEDFGGDSD    141 - 210
DNMDEAIY                                                                  211 - 218
//

Text Mined References (11)

PMID Year Title