Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.25
PubTator Score 6.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3098 2.2e-02

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 4.600 2.2e-02

Gene RIF (3)

PMID Text
18187620 HIV-1 Tat upregulates the transcription by RNA polymerase III of co-transfected or endogenous cellular Alu-repeated sequences by activating transcription factor TFIIIC
18187620 Knockdown of polymerase (RNA) III (DNA directed) polypeptide F (POLR3F) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
1403646 HIV-1 Tat upregulates the transcription by RNA polymerase III of co-transfected or endogenous cellular Alu-repeated sequences by activating transcription factor TFIIIC

AA Sequence

MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNT      1 - 70
GLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINKILKNLESKKLIKAVK     71 - 140
SVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQNPMIQRNSSF    141 - 210
ASSHEVWKYICELGISKVELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPT    211 - 280
GLVRAPCGLCPVFDDCHEGGEISPSNCIYMTEWLEF                                      281 - 316
//

Text Mined References (22)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24107381 2014 Gene duplication and neofunctionalization: POLR3G and POLR3GL.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20888865 2011 PNRC accumulates in the nucleolus by interaction with B23/nucleophosmin via its nucleolar localization sequence.
19631370 2009 RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway.
19609254 2009 RIG-I-dependent sensing of poly(dA:dT) through the induction of an RNA polymerase III-transcribed RNA intermediate.
17612402 2007 PNRC is a unique nuclear receptor coactivator that stimulates RNA polymerase III-dependent transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391170 2002 Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10623476 2000 Isolation and characterization of monoclonal antibodies directed against subunits of human RNA polymerases I, II, and III.
10523658 1999 The TFIIIC90 subunit of TFIIIC interacts with multiple components of the RNA polymerase III machinery and contains a histone-specific acetyltransferase activity.
9171375 1997 Three human RNA polymerase III-specific subunits form a subcomplex with a selective function in specific transcription initiation.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1403646 1992 The human immunodeficiency virus tat protein increases the transcription of human Alu repeated sequences by increasing the activity of the cellular transcription factor TFIIIC.