Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.76
PubTator Score 6.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 2.2e-02

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 4.600 2.2e-02

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNT      1 - 70
GLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINKILKNLESKKLIKAVK     71 - 140
SVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQNPMIQRNSSF    141 - 210
ASSHEVWKYICELGISKVELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPT    211 - 280
GLVRAPCGLCPVFDDCHEGGEISPSNCIYMTEWLEF                                      281 - 316
//

Text Mined References (25)

PMID Year Title