Property Summary

NCBI Gene PubMed Count 73
PubMed Score 3.34
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
hepatocellular carcinoma 547 1.0e-05
ovarian cancer 8520 2.9e-05
osteosarcoma 7950 1.2e-04
pancreatic cancer 2398 1.3e-02
pancreatic carcinoma 562 1.3e-02
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 5 11 3.77 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
hepatocellular carcinoma 1.300 1.0e-05
osteosarcoma -1.849 1.2e-04
ovarian cancer 1.500 2.9e-05
pancreatic cancer 1.100 1.3e-02
pancreatic carcinoma 1.100 1.3e-02

Gene RIF (78)

AA Sequence

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTAR      1 - 70
FSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSF     71 - 140
QY                                                                        141 - 142
//

Text Mined References (74)

PMID Year Title