Property Summary

NCBI Gene PubMed Count 24
PubMed Score 5.61
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.100 1.1e-03
hepatocellular carcinoma 1.100 2.0e-05
pancreatic cancer 1.100 1.5e-03
Multiple myeloma -1.384 1.0e-02
astrocytic glioma 1.500 1.0e-02
ependymoma 1.500 7.2e-03
oligodendroglioma 1.500 3.9e-03
glioblastoma 1.300 7.7e-06
osteosarcoma 1.581 2.3e-07
group 3 medulloblastoma 1.500 1.2e-03
medulloblastoma, large-cell 1.300 7.1e-05
primitive neuroectodermal tumor 1.200 7.2e-05
acute quadriplegic myopathy 1.011 6.1e-05
pancreatic ductal adenocarcinoma liver m... 1.371 1.1e-02
non-small cell lung cancer 1.057 4.8e-15
pediatric high grade glioma 1.100 3.7e-06
atypical teratoid/rhabdoid tumor 1.100 3.7e-06
pancreatic carcinoma 1.100 1.5e-03
nasopharyngeal carcinoma 1.200 1.1e-03
Pick disease 1.400 2.9e-07
ovarian cancer -2.600 1.1e-05

Gene RIF (4)

PMID Text
18194663 The average FIX expression level of the rDNA recombinants was additionally enhanced to that from a strong Pol II promoter as a result of elimination of position effects.
17499043 Human Maf1 protein negatively regulates transcription by all three nuclear Pols. Changes in Maf1 expression affect Pol I-dependent transcription in human glioblastoma lines.
16880508 CK2 has the potential to regulate Pol I transcription at multiple levels, in preinitiation complex (PIC) formation, activation, and reinitiation of transcription.
16055704 PTEN represses RNA Pol I transcription through a novel mechanism that involves disruption of the SL1 complex

AA Sequence

MDPGSRWRNLPSGPSLKHLTDPSYGIPREQQKAALQELTRAHVESFNYAVHEGLGLAVQAIPPFEFAFKD      1 - 70
ERISFTILDAVISPPTVPKGTICKEANVYPAECRGRRSTYRGKLTADINWAVNGISKGIIKQFLGYVPIM     71 - 140
VKSKLCNLRNLPPQALIEHHEEAEEMGGYFIINGIEKVIRMLIMPRRNFPIAMIRPKWKTRGPGYTQYGV    141 - 210
SMHCVREEHSAVNMNLHYLENGTVMLNFIYRKELFFLPLGFALKALVSFSDYQIFQELIKGKEDDSFLRN    211 - 280
SVSQMLRIVMEEGCSTQKQVLNYLGECFRVKLNVPDWYPNEQAAEFLFNQCICIHLKSNTEKFYMLCLMT    281 - 350
RKLFALAKGECMEDNPDSLVNQEVLTPGQLFLMFLKEKLEGWLVSIKIAFDKKAQKTSVSMNTDNLMRIF    351 - 420
TMGIDLTKPFEYLFATGNLRSKTGLGLLQDSGLCVVADKLNFIRYLSHFRCVHRGADFAKMRTTTVRRLL    421 - 490
PESWGFLCPVHTPDGEPCGLMNHLTAVCEVVTQFVYTASIPALLCNLGVTPIDGAPHRSYSECYPVLLDG    491 - 560
VMVGWVDKDLAPGIADSLRHFKVLREKRIPPWMEVVLIPMTGKPSLYPGLFLFTTPCRLVRPVQNLALGK    561 - 630
EELIGTMEQIFMNVAIFEDEVFAGVTTHQELFPHSLLSVIANFIPFSDHNQSPRNMYQCQMGKQTMGFPL    631 - 700
LTYQDRSDNKLYRLQTPQSPLVRPSMYDYYDMDNYPIGTNAIVAVISYTGYDMEDAMIVNKASWERGFAH    701 - 770
GSVYKSEFIDLSEKIKQGDSSLVFGIKPGDPRVLQKLDDDGLPFIGAKLQYGDPYYSYLNLNTGESFVMY    771 - 840
YKSKENCVVDNIKVCSNDTGSGKFKCVCITMRVPRNPTIGDKFASRHGQKGILSRLWPAEDMPFTESGMV    841 - 910
PDILFNPHGFPSRMTIGMLIESMAGKSAALHGLCHDATPFIFSEENSALEYFGEMLKAAGYNFYGTERLY    911 - 980
SGISGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGT    981 - 1050
SFLLHDRLFNCSDRSVAHVCVKCGSLLSPLLEKPPPSWSAMRNRKYNCTLCSRSDTIDTVSVPYVFRYFV   1051 - 1120
AELAAMNIKVKLDVV                                                          1121 - 1135
//

Text Mined References (28)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20208542 2010 PHF8 activates transcription of rRNA genes through H3K4me3 binding and H3K9me1/2 demethylation.
19214185 2009 FACT facilitates chromatin transcription by RNA polymerases I and III.
18194663 2008 Efficient protein expression from the endogenous RNA polymerase I promoter using a human ribosomal DNA targeting vector.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17499043 2007 Mammalian Maf1 is a negative regulator of transcription by all three nuclear RNA polymerases.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16880508 2006 Casein kinase 2 associates with initiation-competent RNA polymerase I and has multiple roles in ribosomal DNA transcription.
16809778 2006 RNA polymerase I-specific subunit CAST/hPAF49 has a role in the activation of transcription by upstream binding factor.
16514417 2006 The chromatin remodelling complex WSTF-SNF2h interacts with nuclear myosin 1 and has a role in RNA polymerase I transcription.
16055704 2005 PTEN represses RNA Polymerase I transcription by disrupting the SL1 complex.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15226435 2004 Multiple protein-protein interactions by RNA polymerase I-associated factor PAF49 and role of PAF49 in rRNA transcription.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
11981034 2002 Molecular recognition of agonist ligands by RXRs.
11953755 2002 Structural characterization of a subtype-selective ligand reveals a novel mode of estrogen receptor antagonism.
11592397 2001 PAF67, a novel protein that is associated with the initiation-competent form of RNA polymerase I.
11250903 2001 hRRN3 is essential in the SL1-mediated recruitment of RNA Polymerase I to rRNA gene promoters.
9582279 1998 Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.
9254723 1997 Constitutive and strong association of PAF53 with RNA polymerase I.
8921381 1996 Molecular cloning of RPA2, the gene encoding the second largest subunit of mouse RNA polymerase I.