Property Summary

NCBI Gene PubMed Count 35
PubMed Score 8.32
PubTator Score 7.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 9.5e-07
lung cancer 4473 1.2e-04
oligodendroglioma 2849 1.3e-02
ependymoma 2514 1.8e-02
non primary Sjogren syndrome sicca 840 2.4e-02

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.300 1.8e-02
oligodendroglioma 1.200 1.3e-02
lung cancer 1.900 1.2e-04
non primary Sjogren syndrome sicca 1.100 2.4e-02
ovarian cancer 1.800 9.5e-07

 GO Component (2)

 MGI Phenotype (1)

Gene RIF (11)

PMID Text
25924900 Inhibition of DNA polymerases a, delra and e by AFP promoter-driven artificial microRNAs may lead to effective growth arrest of AFP-positive HCC cells,as novel strategy for gene therapy
25662213 The results show that the FF483-484 amino acids in the human Poleta (designated F1 motif) are necessary for the interaction of this polymerase with POLD2, the B subunit of the replicative DNA polymerase delta, both in vitro and in vivo.
21372597 DNA polymerase delta catalytic subunit p125 induced by mutant type p53 is associated with hepatocellular carcinoma invasion.
21079801 Results suggest that POLD2 and KSP37 might be potential prognostic biomarkers.
20574454 Observational study of gene-disease association. (HuGE Navigator)
20226869 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18818516 the crystal structure of p50*p66(N) complex featuring oligonucleotide binding and phosphodiesterase domains in p50
18765914 As a first step towards understanding the functional importance of their regulatory subunit interactions, the three-dimensional structure of the p50-p66 heterodimer of human Pol delta has been solved using X-ray crystallography.
12522211 The association of PDIP38 with pol delta was shown to occur in calf thymus tissue and mammalian cell extracts by GST-PDIP38 pull-down and coimmunoprecipitation experiments.
11986310 the interaction of PCNA with DNA polymerase delta is mediated through the small subunit of the enzyme

AA Sequence

MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQ      1 - 70
QHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQ     71 - 140
RIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGE    141 - 210
SLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSRDSINKAKYLTKKTQAASVEAVKMLD    211 - 280
EILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVS    281 - 350
DIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPED    351 - 420
QTVLLVTVPDFSATQTACLVNLRSLACQPISFSGFGAEDDDLGGLGLGP                         421 - 469
//

Text Mined References (41)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25924900 2015 DNA Polymerases as targets for gene therapy of hepatocellular carcinoma.
25662213 2015 FF483-484 motif of human Pol? mediates its interaction with the POLD2 subunit of Pol? and contributes to DNA damage tolerance.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21372597 2010 Significance of DNA polymerase delta catalytic subunit p125 induced by mutant p53 in the invasive potential of human hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21079801 2010 POLD2 and KSP37 (FGFBP2) correlate strongly with histology, stage and outcome in ovarian carcinomas.
20574454 2010 Polymorphisms in the base excision repair pathway and graft-versus-host disease.
20226869 2010 Association between genetic variants in the base excision repair pathway and outcomes after hematopoietic cell transplantations.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
18818516 2008 X-ray structure of the complex of regulatory subunits of human DNA polymerase delta.
18765914 2008 Crystallization and preliminary crystallographic analysis of the complex of the second and third regulatory subunits of human Pol delta.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16934752 2006 The p66 and p12 subunits of DNA polymerase delta are modified by ubiquitin and ubiquitin-like proteins.
16510448 2006 Functional roles of p12, the fourth subunit of human DNA polymerase delta.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16000169 2005 An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit.
15670210 2005 Human Werner helicase interacting protein 1 (WRNIP1) functions as a novel modulator for DNA polymerase delta.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12522211 2003 Identification of a novel protein, PDIP38, that interacts with the p50 subunit of DNA polymerase delta and proliferating cell nuclear antigen.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403614 2002 Reconstitution and characterization of the human DNA polymerase delta four-subunit holoenzyme.
12171929 2002 A proteomics approach to identify proliferating cell nuclear antigen (PCNA)-binding proteins in human cell lysates. Identification of the human CHL12/RFCs2-5 complex as a novel PCNA-binding protein.
11986310 2002 Direct interaction of proliferating cell nuclear antigen with the small subunit of DNA polymerase delta.
11593007 2001 A tumor necrosis factor alpha- and interleukin 6-inducible protein that interacts with the small subunit of DNA polymerase delta and proliferating cell nuclear antigen.
11473323 2001 RPA governs endonuclease switching during processing of Okazaki fragments in eukaryotes.
11027336 2000 Werner protein recruits DNA polymerase delta to the nucleolus.
10978529 2000 Characterization of the 5'-flanking region of the gene encoding the 50 kDa subunit of human DNA polymerase delta.
10852724 2000 Evidence that DNA polymerase delta isolated by immunoaffinity chromatography exhibits high-molecular weight characteristics and is associated with the KIAA0039 protein and RPA.
10811112 2000 WRN or telomerase constructs reverse 4-nitroquinoline 1-oxide sensitivity in transformed Werner syndrome fibroblasts.
10559261 1999 Reconstitution of proliferating cell nuclear antigen-dependent repair of apurinic/apyrimidinic sites with purified human proteins.
9286699 1997 Cloning, chromosomal localization, and interspecies interaction of mouse DNA polymerase delta small subunit (PolD2).
9111189 1997 Which DNA polymerases are used for DNA-repair in eukaryotes?
8530069 1995 Cloning of the cDNAs for the small subunits of bovine and human DNA polymerase delta and chromosomal location of the human gene (POLD2).