Property Summary

NCBI Gene PubMed Count 99
PubMed Score 685.70
PubTator Score 376.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -1.200 2.4e-20
Astrocytoma, Pilocytic -2.100 1.9e-06
ependymoma -1.600 5.7e-03
glioblastoma -1.300 1.9e-03
group 3 medulloblastoma -2.700 2.3e-04
interstitial cystitis 2.800 8.8e-04
medulloblastoma, large-cell -2.100 8.6e-04
oligodendroglioma -1.100 2.8e-02
ovarian cancer -1.500 1.4e-02
pediatric high grade glioma -1.200 2.9e-02
periodontitis 1.500 1.9e-23
primary Sjogren syndrome 1.200 9.8e-04
psoriasis 1.900 4.6e-15
ulcerative colitis 1.800 5.3e-04

Gene RIF (34)

AA Sequence

MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTPCTKVMARSSW      1 - 70
QLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSA     71 - 140
RKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV                                      141 - 176
//

Text Mined References (100)

PMID Year Title