Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.59
PubTator Score 4.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma 1.500 4.4e-04
invasive ductal carcinoma 1.200 2.0e-04
lung cancer 1.600 4.8e-02
malignant mesothelioma 1.400 6.9e-07
medulloblastoma, large-cell 1.300 2.3e-03
osteosarcoma 1.778 9.2e-04
psoriasis 1.500 2.8e-04
tuberculosis and treatment for 6 months 1.500 4.3e-05

Synonym

Accession Q9NRX1 A8K6Q0 Q53G13 Q8WVB8
Symbols RRP20
KHRBP1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (5)

AA Sequence

MESEMETQSARAEEGFTQVTRKGGRRAKKRQAEQLSAAGEGGDAGRMDTEEARPAKRPVFPPLCGDGLLS      1 - 70
GKEETRKIPVPANRYTPLKENWMKIFTPIVEHLGLQIRFNLKSRNVEIRTCKETKDVSALTKAADFVKAF     71 - 140
ILGFQVEDALALIRLDDLFLESFEITDVKPLKGDHLSRAIGRIAGKGGKTKFTIENVTRTRIVLADVKVH    141 - 210
ILGSFQNIKMARTAICNLILGNPPSKVYGNIRAVASRSADRF                                211 - 252
//

Text Mined References (13)

PMID Year Title