Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma 2.200 4.8e-08
astrocytic glioma -1.500 4.6e-02
ependymoma -1.300 3.2e-02
oligodendroglioma -1.300 3.1e-02
psoriasis -1.200 1.1e-03
glioblastoma -1.800 8.8e-03
osteosarcoma 2.291 1.2e-02
cystic fibrosis -3.000 3.6e-05
medulloblastoma, large-cell -1.600 4.9e-05
Duchenne muscular dystrophy 1.271 6.2e-07
autosomal dominant Emery-Dreifuss muscul... 1.448 3.2e-03
Amyotrophic Lateral Sclerosis 1.600 1.5e-07
acute quadriplegic myopathy 1.159 2.0e-03
limb girdle muscular dystrophy 2A 1.034 8.1e-04
intraductal papillary-mucinous adenoma (... -2.200 3.1e-04
intraductal papillary-mucinous carcinoma... -2.500 1.9e-04
intraductal papillary-mucinous neoplasm ... -2.600 2.0e-03
colon cancer -1.200 2.0e-02
adult high grade glioma -1.400 2.6e-04
sonic hedgehog group medulloblastoma -1.400 1.1e-04
subependymal giant cell astrocytoma -1.063 3.7e-02
Breast cancer -2.300 1.8e-05
lung carcinoma 1.300 2.8e-19
Pick disease -1.700 7.2e-03
ovarian cancer 2.800 5.1e-05

AA Sequence

MSKTMAMNLLEDWCRGMEVDIHRSLLVTGIPEDCGQAEIEETLNGVLSPLGPYRVLNKIFVREENVKAAL      1 - 70
IEVGEGVNLSTIPREFPGRGGVWRVVCRDPTQDAEFLKNLNEFLDAEGRTWEDVVRLLQLNHPTLSQNQH     71 - 140
QPPENWAEALGVLLGAVVQIIFCMDAEIRSREEARAQEAAEFEEMAAWALAAGRKVKKEPGLAAEVGSAL    141 - 210
KAETPNNWNATEDQHEPTKPLVRRAGAKSRSRRKKQKKNSRQEAVPWKKPKGINSNSTANLEDPEVGDAE    211 - 280
SMAISEPIKGSRKPCVNKEELALKKPMAKCAWKGPREPPQDARAEAESPGGASESDQDGGHESPPKKKAV    281 - 350
AWVSAKNPAPMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQQPAEATASTSRG    351 - 420
PKAKPEGSPRRATNESRKV                                                       421 - 439
//

Text Mined References (14)

PMID Year Title
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16550607 2006 Identification of novel oligodendroglioma-associated candidate tumor suppressor genes in 1p36 and 19q13 using microarray-based expression profiling.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.