Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
acute quadriplegic myopathy 1.159 2.0e-03
adult high grade glioma -1.400 2.6e-04
Amyotrophic lateral sclerosis 1.600 1.5e-07
astrocytic glioma -1.500 4.6e-02
autosomal dominant Emery-Dreifuss muscul... 1.448 3.2e-03
Breast cancer -2.300 1.8e-05
colon cancer -1.200 2.0e-02
cystic fibrosis 1.491 4.6e-06
Duchenne muscular dystrophy 1.271 6.2e-07
ependymoma -1.300 3.2e-02
glioblastoma -1.800 8.8e-03
intraductal papillary-mucinous adenoma (... -2.200 3.1e-04
intraductal papillary-mucinous carcinoma... -2.500 1.9e-04
intraductal papillary-mucinous neoplasm ... -2.600 2.0e-03
limb girdle muscular dystrophy 2A 1.034 8.1e-04
lung carcinoma 1.300 2.8e-19
malignant mesothelioma 2.200 4.8e-08
medulloblastoma, large-cell -1.600 4.9e-05
oligodendroglioma -1.300 3.1e-02
osteosarcoma 2.291 1.2e-02
ovarian cancer -2.100 1.8e-03
Pick disease -1.700 7.2e-03
psoriasis -1.200 1.1e-03
sonic hedgehog group medulloblastoma -1.400 1.1e-04
subependymal giant cell astrocytoma -1.063 3.7e-02

AA Sequence

MSKTMAMNLLEDWCRGMEVDIHRSLLVTGIPEDCGQAEIEETLNGVLSPLGPYRVLNKIFVREENVKAAL      1 - 70
IEVGEGVNLSTIPREFPGRGGVWRVVCRDPTQDAEFLKNLNEFLDAEGRTWEDVVRLLQLNHPTLSQNQH     71 - 140
QPPENWAEALGVLLGAVVQIIFCMDAEIRSREEARAQEAAEFEEMAAWALAAGRKVKKEPGLAAEVGSAL    141 - 210
KAETPNNWNATEDQHEPTKPLVRRAGAKSRSRRKKQKKNSRQEAVPWKKPKGINSNSTANLEDPEVGDAE    211 - 280
SMAISEPIKGSRKPCVNKEELALKKPMAKCAWKGPREPPQDARAEAESPGGASESDQDGGHESPPKKKAV    281 - 350
AWVSAKNPAPMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQQPAEATASTSRG    351 - 420
PKAKPEGSPRRATNESRKV                                                       421 - 439
//

Text Mined References (14)

PMID Year Title