Property Summary

NCBI Gene PubMed Count 16
PubMed Score 12.02
PubTator Score 65.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8ND90 A8K4L5 O95144 Q8NG07
Symbols MA1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAMTLLEDWCRGMDVNSQRALLVWGIPVNCDEAEIEETLQAAMPQVSYRMLGRMFWREENAKAALLELTG      1 - 70
AVDYAAIPREMPGKGGVWKVLFKPPTSDAEFLERLHLFLAREGWTVQDVARVLGFQNPTPTPGPEMPAEM     71 - 140
LNYILDNVIQPLVESIWYKRLTLFSGRDIPGPGEETFDPWLEHTNEVLEEWQVSDVEKRRRLMESLRGPA    141 - 210
ADVIRILKSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIRLEPLLQKVVEKGA    211 - 280
IDKDNVNQARLEQVIAGANHSGAIRRQLWLTGAGEGPAPNLFQLLVQIREEEAKEEEEEAEATLLQLGLE    281 - 350
GHF                                                                       351 - 353
//

Text Mined References (19)

PMID Year Title