Property Summary

NCBI Gene PubMed Count 16
PubMed Score 12.02
PubTator Score 65.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MAMTLLEDWCRGMDVNSQRALLVWGIPVNCDEAEIEETLQAAMPQVSYRMLGRMFWREENAKAALLELTG      1 - 70
AVDYAAIPREMPGKGGVWKVLFKPPTSDAEFLERLHLFLAREGWTVQDVARVLGFQNPTPTPGPEMPAEM     71 - 140
LNYILDNVIQPLVESIWYKRLTLFSGRDIPGPGEETFDPWLEHTNEVLEEWQVSDVEKRRRLMESLRGPA    141 - 210
ADVIRILKSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIRLEPLLQKVVEKGA    211 - 280
IDKDNVNQARLEQVIAGANHSGAIRRQLWLTGAGEGPAPNLFQLLVQIREEEAKEEEEEAEATLLQLGLE    281 - 350
GHF                                                                       351 - 353
//

Text Mined References (19)

PMID Year Title